Sentencedict.com
 Directly to word page Vague search(google)
Home > Eel in a sentence

Eel in a sentence

  up(3)  down(2)
Sentence count:133Posted:2017-06-09Updated:2020-07-24
Similar words: seelfeelkeelreelpeelheelsteelwheelMeaning: [iːl]  n. 1. the fatty flesh of eel; an elongate fish found in fresh water in Europe and America; large eels are usually smoked or pickled 2. voracious snakelike marine or freshwater fishes with smooth slimy usually scaleless skin and having a continuous vertical fin but no ventral fins. 
Random good picture Not show
121. An eel held by the tail is not yet caught.
122. As Rachel Carson observed, the eel is "a lover of darkness."
123. Diabetes for the seafood: mackerel, salmon, tuna, eel, fish, Pacific saury, lobster, oysters,(www.Sentencedict.com) crabs ... and so on.
124. When I met Miller in his Tokyo office, he ruefully acknowledged that he and Tsukamoto have come tantalizingly close to finding the parents of Japanese eel hatchlings.
125. A ultra performance liquid chromatography-tandem mass spectrometry(UPLC-MS/MS) method was developed for determination of altrenogest and chlormadinone in swellfish, eel and roasted eel.
126. Tiny teeth and yellow nostrils flash as a male blue ribbon eel opens wide in the Fiji Islands.
127. A gulper eel can eat an animal larger than itself and accommodate it an expandable stomach.
128. Conger eel, whole or in pieces, but not minced, prepared or preserved, frozen.
129. The freshwater eel is one of the few fishes that do the opposite, spawning in the ocean and spending their adulthood in lakes, rivers, and estuaries—a life history known as catadromy.
130. Objective To purify the immunoglobulin from Ricefield eel , and to prepare the rabbit polyclonal antisera.
131. The spectrofluorimetric method is described for assaying ciprofloxacin in musculature of crucian, eel, carp and tilapia.
132. A method of detecting mebendazole residue in eel muscles was established.
133. Select wild eel, apply special barbecue sauce and roast the eel till it becomes golden brown.
More similar words: seelfeelkeelreelpeelheelsteelwheelheelskneelkeeledpeelerfeelersteelyfeel outfreelybeelinefeel badfeelingpeelinggenteelnewsreelpinwheelkneelingfeel likefeelingsfeel up tounfeelingcartwheelwheelbase
Total 133, 30 Per page  5/5  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words