Sentencedict.com
 Directly to word page Vague search(google)
Home > Mapped in a sentence

Mapped in a sentence

  up(0)  down(0)
Sentence count:222+7Posted:2017-11-08Updated:2020-07-24
Similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendix
Random good picture Not show
(181) My 12 year old had a lesson in his science course later that day that mapped magnetic fields of a little bar magnet. He showed me the results.
(182) When the packet arrives on the outside network, the NAT router looks at the address translation table and determines that the destination address is in there, mapped to a computer on the stub domain.
(183) Name translation: Input name mapped to more than one output name.
(184) The security constraint in Listing 1, for example, secures all URLs beginning with "/reports/" with a single role called reportEnabled, which can be mapped to multiple groups at deployment.
(185) The data in the tree is mapped into the ordered sequence vector with numerical indicia defining the position of the named data in the ordered sequence vector.
(186) JSON objects are mapped to nodes. Each property is a child node.
(187) Generally, tracks are laid, marked, and mapped on the day previous to the tracking trial by the trial judge or steward.
(188) That is, all shared objects (not only DB2) are mapped to quadrant 3 and 4 in one single space shared by all processes.
(189) Regions in a process's virtual address space can be mapped to physical memory, to a file, or to any other addressable storage.
(190) Multiple file servers can be mapped to the same name,[sentencedict.com] thus providing redundancy and locality of data access.
(191) Software packages are tracked down via the /var/sadm/install directory path, and file systems are mapped to device files like /dev/dsk/c0t0d0s0 with /etc/vfstab.
(192) Then the program's action feature was imported using the external behavior and interface as the supplementary information, the feature was mapped to binary code.
(193) The electrogram data sensed at each of the plurality of locations in the heart is mapped to a corresponding element of the FEM.
(194) Pre-Jurassic palaeogeomorphology of Zhenjing oilfield has been mapped by mold method according to well cores, cast liquid photos and petrophysical data, as well as interpretation of well logs.
(195) The ANN can take into account various types of information, such as patient data, hem data, lead information, etc. , in addition to the electrogram data mapped to each element in the FEM.
(196) The following illustration shows the original image and the image mapped to the parallelogram.
(197) You have four source attributes mapped to one target attribute.
(198) Multiple addresses can be mapped to a single address because each private address is tracked by a port number.
(199) The TMap activities mentioned below are part of the Execution phase and are mapped to the corresponding RUP activities, shown in Table 5.
(200) In the render on the right, the same texture was mapped to just the Incandescence channel.
(201) A symbol is a resource identifier (ID) that consists of two parts: a text string (symbol name) mapped to an integer value (symbol value).
(202) By using the ray tracing method, the scattering from all cells of scatters under a certain radar resolution is mapped into the image pixels.
(203) In this study, genetic analysis of a wild emmer wheat accession 21449 was carried out, and one recessive resistance gene in 21449 was mapped with microsatellite markers.
(204) The fast coding method is a component of the CMG study. It has practicability in a novel electronic combination lock which mapped the discrimination principle of the CMG mechanism.
(205) IDS.DEFAULT.SERVICE is mapped to system default queue manager, queue named IDS.DEFAULT.QUEUE, and default code set.
(206) The clock face has the 24 hours of the day mapped out around the edge with midnight being at the 12 position and noon being at the 6 position.
(207) Blue regions represent virtual addresses that are mapped to physical memory, whereas white regions are unmapped.
(208) Foundation of the modern service definition technique - functional decomposition is not easily mapped to the enterprise data.
(209) The class II terpene synthase producing syn-copalyl diphosphate from the universal diterpenoid precursor geranylgeranyl diphosphate was also mapped to this same region.
(210) So far her team has mapped out how climate change might alter the habitats of a dozen species, from the Canadian lynx to the California redwood.
More similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendixuntappedstrappedwrapped upsnow-cappedunwrappedkidnappedsnowcappedhandicappedwhippersnappermappingmap projectionrippedpoppeddippedtoppedtippedclippedcroppedsteppedwhippedchoppedstopped
Total 222, 30 Per page  7/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words