Sentencedict.com
 Directly to word page Vague search(google)
Home > Mapped in a sentence

Mapped in a sentence

  up(0)  down(0)
Sentence count:222+7Posted:2017-11-08Updated:2020-07-24
Similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendix
Random good picture Not show
(211) Because each component is mapped separately, two components which happen to use the same resource name may not necessarily be bound to the same container resource.
(212) In this example, the ProductDisplay command name was mapped to product, and each URL parameter value was appended to the product string in sequential order.
(213) For the basic IDL datatypes, the holder class name is the Java type name, with its initial letter capitalized, to which the datatype is mapped with an appended Holder (for example, IntHolder).
(214) According to the principles of cognitive task analysis, a frame and a procedure to be strictly executed were mapped out for the prior assessment of higher mathematics test items.
(215) Finally, the output step can now be completely mapped as shown in the mapping table below.
(216) Now, when any user logs into Rational Application Developer using the Citrix client, the login script will run, and the Citrix server S drive will point to each client that is mapped to the M drive.
(217) The drops created by cloud models were mapped to new universe of discourse and immediately the X-term cloud generation was used to gain the results of soft-and by the former method.
(218) The road of salvation was mapped out from the cradle to the grave.
(219) Based on this[sentencedict .com], every image frame is mapped from spatial domain to statistical domain.
(220) Any response or fault message is mapped out to the status field in the return message.
(221) Figure 1: Documentation icons, mapped onto the standard Rational Unified Process chart, indicate locations in the project lifecycle where documentation may be needed.
(222) Some kiosks make use of hardware buttons mapped to onscreen functions in lieu of touch screens.
More similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendixuntappedstrappedwrapped upsnow-cappedunwrappedkidnappedsnowcappedhandicappedwhippersnappermappingmap projectionrippedpoppeddippedtoppedtippedclippedcroppedsteppedwhippedchoppedstopped
Total 222, 30 Per page  8/8  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words