Sentencedict.com
 Directly to word page Vague search(google)
Home > Dieting in a sentence

Dieting in a sentence

  up(0)  down(0)
Sentence count:118+7Posted:2017-08-31Updated:2020-07-24
Similar words: disquietingdieticiandietitiandieteticserythropoietinmeetingbudgetingcompletingMeaning: ['daɪət]  n. the act of restricting your food intake (or your intake of particular foods). 
Random good picture Not show
61) For health reasons, I am unable to exercise, so will I be able to lose weight by dieting alone?
62) A word about your weight loss From the day you start F-Plan dieting you will start shedding surplus fat.
63) It is obvious these individuals think fat people can become thin if they just start dieting and exercising.
64) As dieting progresses, the feeling hardens into voracious hunger; restlessness gives way to energy-conserving lethargy.
65) Brownell and Rodin are two of the most moderate obesity researchers who have been influential in identifying the risks of dieting.
66) That was 10 years ago and since then I've researched and developed that simple dieting principle.
67) That nasty shock should emphasize the importance of low-fat simplicity in restaurant meals while dieting.
68) Another variation on repetitious dieting involves having a liquid protein drink instead of a meal.
68) Sentencedict.com try its best to collect and build good sentences.
69) Still, in their journal articles, these researchers are cautious about telling people to give up dieting.
70) The report sparked the first nationwide debate over whether low-calorie dieting was now outmoded.
71) On average, she vomited twice daily and was obsessed with dieting.
72) She freely quoted eating disorders experts who had long opposed dieting but had received little ink for their efforts.
73) Numerous studies show that dieting is useless and may even cause weight gain.
74) Are you going to invest it in cosmetics or weight training or dieting?
75) Signs of the disorder include picking at the skin, frequently touching the perceived problem area, excessive dieting or exercise.
76) All of these programs teach people to stop dieting and eating compulsively, but there are differences among the methods.
77) For all the dieting and exercise that have been resorted to, often despairingly, they have in many cases gotten bigger.
78) Several techniques have been developed to teach demand feeding to adults, to help them stop dieting and learn to eat normally.
79) It's easy to blame the public for being gullible enough to buy dieting products, but it's the companies who sell them who should take responsibility.
80) We turned our strongly held ideas about dieting and thinness upside down.
81) Perhaps you might even feel like not dieting for one or two days.
82) First, the good news: Waterhouse wants you to stop dieting.
83) Some of the studies showed that yo-yo dieting has clear detrimental effects, and others did not.
84) However divorce is as effective as dieting for shifting stubborn weight!
85) Crash dieting and yo-yo dieting, on the other hand, will have the opposite effect.
86) Nor do they typically describe the psychological effects of dieting in their scientific papers.
87) The result is that you feel full for longer and don't have the sweet cravings that can come with dieting.
88) It's time to end the self-defeating cycle of overeating and dieting.
89) In the end only 11 percent said they did not particularly lose more inches than previous dieting attempts had produced.
90) Dieting is good insofar as it prevents gluttony.
More similar words: disquietingdieticiandietitiandieteticserythropoietinmeetingbudgetingcompletingcompetinggreetingrivetingfleetingmarketingpocketingbuffetingpicketingdietinterpretingboard meetingmeeting placedietarysummit meetingtelemarketingmarketing managerdietary fiberbalanced dietmacrobiotic dietninetiethproprietiesget in
Total 118, 30 Per page  3/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words