Sentencedict.com
 Directly to word page Vague search(google)
Home > Budgeting in a sentence

Budgeting in a sentence

  up(0)  down(2)
Sentence count:168+2 Only show simple sentencesPosted:2017-05-20Updated:2020-07-24
Similar words: budgebudgetbudgetarybudgerigarstate budgetbudget surplusbudget deficitbalanced budget
Random good picture Not show
(1) Even with efficient budgeting, most students are unable to live on £4,000 per year.
(2) We have continued to exercise caution in our budgeting for the current year.
(3) A successful budgeting process must include two vital elements.
(4) Fixed interest rate and monthly repayments for easy budgeting.
(5) Personal computers also have simplified capital budgeting.
(6) An alternative approach is programme budgeting.
(7) Infrastructure for planning, budgeting, and oversight was needed.
(8) Politicians tend to support the traditional approach to budgeting.
(9) Programme budgeting was never formally introduced by the government.
(10) Decentralisation and participatory budgeting challenge neoliberalism.
(11) A systems approach to budgeting that focuses on the outcomes and objectives of government policy can not avoid controversy.
(12) Budgeting your time Before the exam begins(sentencedict.com), listen carefully to the instructions given by the invigilator.
(13) Defence budgeting and procurement do not move along different tracks from defence policy as a whole.
(14) Consequently, he was budgeting for a deficit of about A$5,600,000.
(15) The financial administrative functions include budgeting, accounts payable, accounts receivable, general ledger, payroll and personnel.
(16) In the budgeting process the firm should decide on what should be treated as profit centres and what as cost centres. Sentencedict.com
(17) Budgeting loans are paid back by weekly deductions from benefit.
(18) Reporting structures and planning, budgeting, and compensation systems, for example, remain wholly or significantly the same.
(19) In order to deal with the problems of budgeting for this it is necessary to know something of company financial and cost accounting.
(20) The internecine struggles over budgeting between the services is as intense as the battles between defence and social welfare programmes.
(21) Budgeting Loans are repayable and are not available to help towards mains fuel consumption and standing charges.
(22) A free low-interest credit card can be a useful budgeting tool.
(23) Since the opt-out, the hospital has been responsible for its own budgeting.
(24) The system illustrated here follows a logical sequence of development resulting in a short-term financial planning and cash budgeting system.
(25) The actual implementation of these programs involves collection of revenues and disbursement of public money, budgeting, accounting, and purchasing.
(26) They have demonstrated that it is possible to construct systems of clinical budgeting in acute hospitals.
(27) It has evolved as an idea from a previous initiative in 1983 known as management budgeting.
(28) In addition to net present value, the internal rate of return on a capital budgeting project is also calculated.
(29) The marginal cost of capital is the discount rate that should be used in making capital budgeting decisions.
(30) They are suddenly faced with finding a place to rent and budgeting the cost of living.
More similar words: budgebudgetbudgetarybudgerigarstate budgetbudget surplusbudget deficitbalanced budgetcutting edgemeetingrivetingfleetinggreetingpicketingmarketingdisquietinginterpretingsummit meetingnudgefudgejudgegrudgesmudgecudgeldrudgesludgetrudgeadjudgemarketing managermisjudge
Total 168, 30 Per page  1/6  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words