Sentencedict.com
 Directly to word page Vague search(google)
Home > Ceramide in a sentence

Ceramide in a sentence

  up(0)  down(0)
Sentence count:26Posted:2021-01-20Updated:2021-01-20
Similar words: ceramicceramistceramicsbioceramicceramic warepyramidamidepyramidal
Random good picture Not show
1. Ceramides - a major component of lipids.
2. Ossein, ceramide, Bulgarian rose essential oil.
3. Objective To explore the effect of ceramide on MTT metabolism rate of mouse cortical neuron.
4. Ceramide as an important member of sphingolipid is a second messenger responsible for regulating cellular activities, whose major function is to transmit growth-inhibiting signals including apoptotic.
5. Objective To investigate the relationship between ceramide and apoptosis of granulosa cells.
6. The findings therefore identify ceramide as a target for therapies aimed at improving insulin response and blood sugar control, the researchers said.
7. As ceramide accumulates, it inflames the lung and kills lung cells.
8. They found that increased ceramide levels are a requirement of impaired insulin response in mice given a glucocorticoid used to treat rheumatoid arthritis.
9. Ingredients: Hyaluronic acid, collagen, ceramide, aesculetin essence, cat's-foot extract etc.
10. Ceramide is a lipid molecule naturally present in the cell's plasma membrane and controls cell functions, including cell aging, or senescence.
11. Ceramide emerges as a regulator of cell growth, differentiation and apoptosis.
12. Mice with too little ceramide are unable to fight off lung infections.
13. The ceramide hair iron is considered gentler and effective, but it comes with a higher price tag.
14. In this article the author will focus on studying the application of ceramide in anti-tumor treatment.
15. METHOD Sphingomyelin was prepared through the process of separating erythrocyte from blood, erythrocytolysis, dehydration, dry, et al, and then hydrolyzed to ceramide by phospholipase C.
16. This results in accumulation of a sticky lipid called ceramide.
17. OBJECTIVE To extract the sphingomyelin from erythrocyte membrane and hydrolyze it to ceramide.
18. Sphingomyelin synthase (SMS), the last key enzyme in the sphingomyelin (SM) biosynthetic pathway,[sentencedict.com/ceramide.html] uses ceramide and phosphatidylcholine (PC) as substrates to produce SM and diacylglycerol (DAG).
19. And in laboratory experiments with blood vessels from rats, they were able to inhibit ceramide synthesis.
20. A novel method , fluorophotometry, was used to determine Vitamin A in galactosyl ceramide liposomes.
21. The present study was undertaken to investigate the effects of ceramide on progesterone production and apoptosis in rat luteal cells in vitro.
22. By blocking Asm, Elavil causes the body to make less ceramide.
23. The sphingomyelin pathway is a ubiquitous signaling system, in which ceramide acts as a second messenger.
24. INGREDIENTS: VE . VB 5 . natural moisturizing factor HA . Water - solubility Ceramide . Essential Oil.
25. The researchers found that these metabolic stresses lead to an upswing in production of a particular kind of fat molecule, known as ceramide.
26. Animals genetically altered in a way that limited their synthesis of ceramide didn't become insulin resistant when taking the drug as normal animals did.
More similar words: ceramicceramistceramicsbioceramicceramic warepyramidamidepyramidalpyramidingfood pyramidgreat pyramidcarbamideacetamidepolyamidepyramid schemeifosfamideacrylamidepyramidal tractextrapyramidalpyramid sellingsulfonamidepyramids of egyptsulfanilamidepolyacrylamidecyclophosphamideforaminiferalysergic acid diethylamideamidamidoamidst
Total 26, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words