Sentencedict.com
 Directly to word page Vague search(google)
Home > Widening in a sentence

Widening in a sentence

  up(1)  down(0)
Sentence count:175+4Posted:2017-11-18Updated:2020-07-24
Similar words: maddeninghardeningdeadeningsaddeninggardeningemboldeningwidenadenineMeaning: ['waɪdn]  n. 1. an increase in width 2. a part of a road that has been widened to allow cars to pass or park 3. the act of making something wider. 
Random good picture Not show
151. But Mr. Wu sees the defects: a government prone to “meddling” in the marketplace; a widening income gap; inefficient monopolies; and crony capitalism.
152. Since last year, widening the scope of Somali piracy, attacks extend to the waters near the Mozambique Channel, and has penetrated the eastern Indian Ocean waters.
153. The membrane injured by NMDA becomes disintegrated, its protein particles gathering augmenting, its lipid incisure deeper, the spacing widening and the surface rougher.
154. The widening of China's current income distribution gap, which is concerned by people, is a projecting question in the distribution field.
155. Widening cavity of the esophagus may be indirect sign of the hiatal hernia.
156. The main amplifier uses proportion enlargement, widening the bandwidth, recording richer earth decline information, which can be well used in the earthquake forecast.
157. Meanwhile, the company undertakes the window sill processing of arc , widening and lengthening.
158. Shadow income is behind the widening income gap in China and an ever-more imbalanced distribution of public wealth.
159. In addition, the widening scope of activities of Somali pirates attacked the coverage has been extended to the waters near the Mozambique Channel, and in-depth eastern Indian Ocean.
160. In-situ check experiments testify that the spiral V-notch blasting is applicable to engineering projects and have a good advantage in controlling the size of blasted blocks and widening blasted range.
161. It is shown that the distress resulted essentially from the instable integration and the incoordinate deformation between the existing subgrade and the widening one.
162. Application: Pavement reinforcing, anti - cracking, widening and urban roads upgrading.
163. Although the ACPP has been attached a importance since China's reform and open, the urbanized development strategy still continued which leaded to a widening gap between city and country.
164. Official Development Assistance (ODA) fell, widening the gap between the availability of aid and the needs of the poorest countries.
165. The recession has hit middle-income and poor families hardest, widening the economic gap between the richest and poorest Americans as rippling job layoffs ravaged household budgets.
166. Widening conversions preserve the source value but can change its representation.
167. The Big Four who built and owned the Southern Pacific Railroad—Mark Hopkins, Charles Crocker, Collis P. Huntington, and Leland Stanford—typified the widening social chasm.
168. The work in Harwich included widening of footpaths, road resurfacing, new benches and other street furniture.
169. NURSE: The creature's pressure is bottoming out, his complexes are slow and widening.
170. China, with its centrally controlled economy, managed currency and restrictions on capital inflows[sentencedict.com], has become a haven for investors fleeing widening global debt turmoil.
171. What's more, they suggested widening thethe almsman and building the new charities. "
172. Hence, a refutation of Acheson may benefit many Chinese by widening their horizon.
173. For example, the condition acne rosacea is caused by permanent widening of the blood vessels of the skin of the cheeks and nose.
174. To hedge against the widening of the spread, the company could purchase a put option with a strike at the current level of spread.
175. The paper offered formula for widening the curve railway, concluded theoretic widening radius of curve railway and widening value, which offers reference for platelayer.
More similar words: maddeninghardeningdeadeningsaddeninggardeningemboldeningwidenadenineopeningeveningmeningesgreeningwakeningraveningripeningfatteningconveningleaveninglisteninghappeningdeafeningmeningeallesseningchasteningdeepeningworseningsofteningdampeningawakeningscreening
Total 175, 30 Per page  6/6  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words