Sentencedict.com
 Directly to word page Vague search(google)
Home > Inlet in a sentence

Inlet in a sentence

  up(2)  down(1)
Sentence count:154+1Posted:2017-08-09Updated:2020-07-24
Synonym: entranceentryopeningpassagewaySimilar words: sinlessrainlesspainlesschainlessstainlessin league withstainless steelunlessMeaning: ['ɪnlet]  n. an arm off of a larger body of water (often between rocky headlands). 
Random good picture Not show
91. Yeats spent much of his childhood with his grand-uncle in Ballysadare village, at the head on an inlet off Sligo Bay and known by some locally as "Sally."
92. The capital and largest city of Northern Ireland, in the eastern part of the country on Belfast Lough, an inlet of the North Channel of the Irish Sea.
93. A tropical storm warning was issued from Cape Fear to Bogue Inlet , North Carolina.
94. The result indicates that temperature at the inlet of catalyst bed is the most optimal control parameter to realize the optimal operation of ammonia converter.
95. Some factors of effect i. e. cavitation number and inlet pressure are discussed and the decompositional regular is proposed.
96. The supersonic combustion chamber inlet is a 2 D convergent - divergent nozzle.
97. The results of the simulation indicate:compared with cyclone in other domain, the secondary flow of the preheating cyclone with pentagonal inlet and three core volute structure is relatively weaker.
98. A superconductive airflow chamber and a water inlet chamber are arranged in the superconductive chamber in parallel, and the water inlet chamber is provided with drain slots and a water inlet pipe.
99. The air pressure at the hot value inlet does not become excessively low.
100. In this method, the dispersion and overall change of the cavities'frequency can be controlled by changing water flux and inlet temperature of cooling water.
101. In this paper, the inlet condition of core shooting process has been studied with a high speed digital camera, and the initial velocity of sand flow has been measured.
102. These clamp-on thermometers have springs which hook around the inlet and outlet pipes of a radiator.
103. Never swap gauges or inlet fittings, and never change gas service.
104. The experimental results show that the ISC has a relatively high volumetric evaporative coefficient, which increases with the rising of inlet air flow rate and the rising of inlet air temperature.
105. The online optimization control of variable inlet guide vane was studied for minimum fuel consumption, and the effect of variable inlet guide vane on the turboshaft engine was analyzed.
106. The inlet pipe of each pump has an inlet filter to protect pump from being damaged by big particles.
107. Connect the air inlet hose to the throttle body and the air cleaner.
108. Once needing sinkage, the semi-spherical containers can be gradually opened for water inlet; when gravity is equal to buoyancy, the diving device can suspend in the water.
109. The utility model is composed of a tube body (1), a funnel-shaped outlet (4) and a funnel-shaped inlet (7). A spring (2) is buried in the wall of a tube body.
110. Then, the water is injected through the water inlet pipe (6). Stemming (11) is eliminated by the permeation of the water and the self pressure of tap water.
110. Sentencedict.com try its best to gather and create good sentences.
111. The fresh - air inlet was usually the crankcase breather cap.
112. Many elements such as models of fuse plug and circuit breaker, the connecting terminal of inlet and outlet wire and air break switch can be installed in the meter box.
113. Both eliminators and inlet baffles are normally installed in a vertical position.
114. A detailed numerical simulation study was conducted of the flow distribution in the heating surface tubes of a boiler roof superheater featuring a distribution header with a bent inlet.
115. Width, site, color and inlet or outlet connector of process pipeline.
116. The vaporized refrigerant vapor from the low temperature and low pressure, suction inlet of the compressor to be compressed, compressed and then discharged into the next cycle.
117. The liquid concentration inside packing of RPB increases when gas flow rate, rotating speed or the SO2 concentration at gas inlet increases, but decreases when the liquid flow rate increases.
118. A new casting technology for inlet manifold in tilt casting machine for gravity die casting was described.
119. The capital of Maryland, in the central part of the state on an inlet of Chesapeake Bay south-southeast of Baltimore.
120. At a given air inlet condition and airflow rate, meanwhile, dryness of air outlet was required, proper heat-transfer area and matching refrigeration system are obtained through calculating.
More similar words: sinlessrainlesspainlesschainlessstainlessin league withstainless steelunlesssunlesson leaveunleashunleadedunlearnedmotionlessunleavenedemotionlessin-lawinlayinlanddirectionlessunless and untilin luckmainlyin-lawsthinlyinlaidvainlyin linein loveplainly
Total 154, 30 Per page  4/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words