Sentencedict.com
 Directly to word page Vague search(google)
Home > Inlet in a sentence

Inlet in a sentence

  up(2)  down(0)
Sentence count:154+1 Only show simple sentencesPosted:2017-08-09Updated:2020-07-24
Synonym: entranceentryopeningpassagewaySimilar words: sinlessrainlesspainlesschainlessstainlessin league withstainless steelunlessMeaning: ['ɪnlet]  n. an arm off of a larger body of water (often between rocky headlands). 
Random good picture Not show
1. There is an inlet to a parking lot.
2. Mission Valley was a navigable inlet.
3. The valley sides steepened into a fjord-like inlet.
4. He followed the shoreline toward the inlet.
5. Interview, June 6, 1989, Angle Inlet, Minnesota. 9.
6. The top connector is for the inlet from the pump and the bottom for the outlet to the vat.
7. The Inlet covers 6,500 hectares of inter-tidal land between the Gower Peninsula and Llanelli.
8. The inlet is an almost perfect semi-circle backed by huge cliffs whose vegetation-hung rocks defy their position.
9. Fresh hydrogen gas is charged to the inlet of the reactor to balance consumption.
10. The gas phase is recycled to the reactor inlet to provide a large excess of hydrogen gas in the catalytic reaction zone.
11. The ankles, the join of the hips, the inlet of the clavicle, the hair.
12. Maybe she missed the channel into Angle Inlet by only a fraction of a mile, a miscalculation of gradient or degree.
13. There is a filter on the inlet side of the fuel pump which may be partially blocked and obstructing fuel flow.
14. Below, in a steep dark inlet, grey seals would pup in the autumn in the tiny inaccessible cove.
15. They went to a fishing village on a small inlet of the sea.
16. They made it to the marina, got launched and out the inlet without discussion.
17. Forget garage servicing-you could send a Jack Russell down the fuel inlet tracts to carry out a bore inspection.
18. Sliding the on/off plate back to on triggers the heating element and also shuts off the water inlet, preventing drips.
19. It was almost twilight when they tied up at the Angle Inlet boatyard.
20. Just before Jotan vanished completely into the mist, he walked softly out of the inlet between the buildings and followed him.
20. Wish you can benefit from our online sentence dictionary and make progress every day!
21. You can even get a hot meal free from the Red Cross, down at the inlet.
22. There was a deepwater anchorage a few miles downstream, in an inlet of Bridgemarsh Island.
23. The road made a last sharp turn and ran straight west along the shoreline into Angle Inlet.
24. All new ballvalves should be provided with a servicing valve on the inlet pipe.
25. Sludge - another corrosion by-product - can block the inlet or outlet to the radiator and prevent it from heating up.
26. Long ago the Vikings had a village where their ships' crews rested and sheltered in the inlet of the River Hull.
27. The small village, no more than 20 wooden and canvas shacks, sat on the edge of a coastal inlet.
28. They passed out of sight on their way to the inlet where Orestes' ship lay.
29. It twisted into an origami boat and sailed off towards a sewer inlet.
30. An inner spiral has also been added to deflect swirling grain from the cyclone's inlet pipe, minimising wear.
More similar words: sinlessrainlesspainlesschainlessstainlessin league withstainless steelunlesssunlesson leaveunleashunleadedunlearnedmotionlessunleavenedemotionlessin-lawinlayinlanddirectionlessunless and untilin luckmainlyin-lawsthinlyinlaidvainlyin linein loveplainly
Total 154, 30 Per page  1/6  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words