Sentencedict.com
 Directly to word page Vague search(google)
Home > Deleting in a sentence

Deleting in a sentence

  up(0)  down(0)
Sentence count:64Posted:2019-01-02Updated:2020-07-24
Similar words: delegatingtelemarketingdeletiondelimitingmarketing planningdietingsheetingmeeting
Random good picture Not show
31. It can be as basic as a program that spares us from the tediousness of deleting spam from our email, or as evolved as one that simulates human interaction to answer customer service questions.
32. We can easily transplant the system into other domains such as faxes encrypting, IP Phone and private data network by changing the interfacing circuit and adding or deleting software modules.
33. Using homology method, mutant ricin toxin A-chain(MRTA) deleting part of amino acid sequence was modeled by molecular mechanics optimization and molecular dynamics simulated annealing.
34. A document retention policy includes both deleting and wiping electronic documents, however, is not without concerns.
35. Deleting a purpose will reset this CTL. Do you want to continue?
36. If so, you'll need to go to each website where you're using your Windows Live login credentials and delete your accounts there prior to deleting the Live account itself.
37. The short code block in Listing 22 demonstrates how you can display a message to the console upon any adding, deleting, or changing a record in the RMS.
38. The F4 shortcut will repeat nearly all the actions you take on document text: typing: formatting, deleting.
39. Unfortunately these techniques often involve breaking up data at the block level and redistributing it, or deleting it based on meta-data tables.
40. You might need to modify or re-export the security model if you modify your cube model by, for example, deleting or renaming dimensions.
41. That is the fateful and feeble part. The dissertation discusses the sensorless vector control for the sake of deleting optical encoder.
42. Searching for legitimate e - mails and deleting spam used some 80 % of energy.
43. The guidance model feeds project- specific architectural decision models in a tailoring step that might involve deleting irrelevant issues, enhancing relevant ones, or adding new issues.
44. A document retention policy that includes both deleting and wiping electronic documents, however, is not without concerns.
45. A CNF formula F is minimal unsatisfiable if F is unsatisfiable and the resulting formula deleting anyone clause from F is satisfiable.
46. This algorithm uses special data structure to construct index table, and can support inserting, deleting and updating route dynamically.
47. After deleting pointer, the pointer becomes what is referred to as a dangling pointer.
48. It is very efficient for segmenting cell paste and deleting background area attaching to cell body. Scissor-cut technique can applied to other fields besides biologic object also.
49. Note: Use APPEND to avoid deleting the existing content of the file.
50. The average hospitalization costs decreased after deleting valueless period of hospitalization,[Sentencedict.com ] and the hospital' s income rose each day.
51. Note: Use FILE _ APPEND to avoid deleting the existing content of the file.
52. In those texts, we select bigram as feature after Chinese word segmentation, deleting stop word and other process.
53. This paper introduces the trunk organization, creation and deleting of incoming route and outgoing route for S12 J family digital program control exchange.
54. Deleting the private keys to change the current security level.
55. Rebasing is about safely doing this and then deleting the old 1.0 based versions so they don't clutter the tree.
56. Fixed Null Reference Exception when deleting a that has holes in it.
57. Since deleting an ACE_Task object doesn't shut down any active threads, the threads must therefore exit before the task object can be deleted.
58. In this paper, We study the perturbation problem of eigenvalue of a simple graph G to adding and deleting an edge.
59. To alter ( a legislative measure, for example ) formally by adding, deleting, or rephrasing.
60. Time Machine also will alert you that it will start deleting previous backups, oldest first.
More similar words: delegatingtelemarketingdeletiondelimitingmarketing planningdietingsheetingmeetingfleetingfilletingcompetingbudgetingcompletinggreetingsweetingrivetingmarketingbuffetingpocketingobsoletingcarpetingbucketingbanquetingpicketingjunketingexcretingcrochetingtown meetingbracketingblanketing
Total 64, 30 Per page  2/3  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words