Sentencedict.com
 Directly to word page Vague search(google)
Home > Simplex in a sentence

Simplex in a sentence

  up(0)  down(0)
Sentence count:156Posted:2018-01-09Updated:2020-07-24
Similar words: herpes simplexsimplesimplersimpletonsimple sugarsimple-mindedpure and simplesimplemindedMeaning: ['sɪmpleks]  adj. 1. allowing communication in only one direction at a time, or in telegraphy allowing only one message over a line at a time 2. having only one part or element. 
Random good picture Not show
61 Conclusion The simplex and triplex PCR approach based on highly specific hot-start PCR might be useful for quick detection of deep fugal infection in routine clinical laboratory practice.
62 It can be obtained by applying directly twist operation under a table and need not input artificial variable. After this, we may find optimal solution under the table as the same as simplex method.
63 Corticosteroids should be used cautiously in patients with ocular Herpes simplex because of possible corneal perforation.
64 A few opportunistic infections and symptoms such as candidiasis of the mouth, throat or vagina (thrush), herpes zoster (shingles) and herpes simplex can be managed effectively through home-based care.
65 A real-coded hybrid genetic algorithm (HGA) was designed by hybridizing the simple genetic algorithm and simplex algorithm to solve unconstrained optimization problems.
66 This paper presents an improved (infeasible) simplex method for linear programming, in which some of vertex points, corresponding to the iterative process, can be out of the feasible domain of (LP).
67 Herpes Simplex I virus remains dormant in the nerve cells of the body.
68 The abecedarian numerical computation shows that the new algorithm is more effective than the primary simplex algorithm.
69 These include giant cells associated with variola, herpes simplex and parainfluenza.
70 An Indian scientist claims to have identified two plants in the Nilgiri hills that may contain a cure for life-threatening diseases caused by Herpes Simplex Virus (HSV).
71 At present, the mainly applied virus vectors are retroviral vector, adenovirus vector adenovirus-associated virus slow virus vector, herpes simplex virus vector and so on.
72 Objective : To investigate therapeutic effect of cornea toxicide for treating herpes simplex viral keratitis.
73 In this algorithm, the inlaid fitness function based on the table task or the simplex search is designed, and the genetic operational method ensuring the floating-point coding validity is adopted.
74 Basic theory and methods of Linear programming, which include duality principle, simplex method and linear programming problems with particular cases.
75 ObjectiveTo identify Thalictrum simplex L. var. bravipes Hara by identification of pharmacognosy and provide the scientific evidence of identification and application.
76 The abecedarian numerical computation shows that the new algorithm is more effective than simplex algorithm.
77 Herpes simplex keratitis ( HSK ) is one of the most important causes of blindness.
78 Based on ITAE guideline,[http://sentencedict.com/simplex.html] three parameters of PID controller are optimized by using simplex method.
79 It has more advantages than primal simplex algorithm, two-stage simplex algorithm and dual simplex algorithm.
80 Commonly in additional to simplex method and dual simplex method, another original dual method can solve the liner programming.
81 Make comprehensive experiments instead of the simplex confirmative experiments to reform existing experimental teaching models and methods.
82 Methods:Cytotoxity of acyclovir(ACV)on Vero cell and antiviral activity of ACV on herpes simplex virus type 1(HSV-1)in vitro were detected using two methods.
83 Based on the in-depth analysis of genetic algorithm and simplex algorithm and with the combination of the two, the paper proposes the simplex immune hybrid algorithm.
84 Herpes simplex virus ( HSV ) gains entry through abraded skin or mucosal tissue.
85 A viral infection caused by the herpes simplex virus type 2, occasionally type 1.
86 The control strategies under different wind speed have been analyzed and obtained the optimal tip speed ratio using the simplex algorithm.
87 Results show that with simplex method, optimum sensitivity can be obtained with fewer experiments.
88 This is typical for Herpes simplex virus ( HSV ) infection.
89 Objective To investigate the combined clinical effect of trace corticosteroid and antiviral agent against herpes simplex keratitis (HSK).
90 The heuristic implicit enumeration presented in this thesis can effectively solve this kind of problems. It is different from other algorithms, such as simplex, cutting plane method, etc.
More similar words: herpes simplexsimplesimplersimpletonsimple sugarsimple-mindedpure and simplesimplemindedsimple machinesimple interestsimple sentencecomplexsimplysimplifycomplexitycomplexionsimplifiedsimplicitysimplisticgolgi complexwimplepimpledimpleoversimplifydimpledpimpledcrimpleelectra complexoedipus complexcomplex sentence
Total 156, 30 Per page  3/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words