Sentencedict.com
 Directly to word page Vague search(google)
Home > Shrink-wrap in a sentence

Shrink-wrap in a sentence

  up(0)  down(0)
Sentence count:21Posted:2018-03-24Updated:2020-07-24
Similar words: shrink-wrappedshrinkshrinkingshrinkageshrinkableshrink fromshrinking violetshrineMeaning: n. the clinging transparent plastic film that is used to shrinkwrap something. 
Random good picture Not show
1. The software is shrink-wrapped and reportedly channel-ready.
2. The net result won't be shrink-wrapped software.
3. It was in a shrink-wrap cellophane coating, and the seal was impermeable.
4. Microport thinks it is the first Unix Labs licensee to make the compiler available in shrinkwrapped form.
5. It already recycles plastic shrink-wrap into shopping bags, and 550 own-brands products are packed in recycled cardboard.
5. Sentencedict.com try its best to gather and create good sentences.
6. CustomerQ 2.0 is Quintus' first attempt at a shrink-wrapped package.
7. Univel is to shrink-wrap the desktop Unix contender and integrate it with Novell's NetWare networking technology.
8. Made from cellulose, this shrink-wrap decomposes in a few weeks in a compost rubbish or in an industrial composter .
9. Shrink-wrap contract is the major form in computer software transaction. It is also a new type of standard contract at the Internet times.
10. A lot of the fresh food sold in supermarkets is shrink-wrapped.
11. Forget your Rollercoasters and Lollapaloozas, this is burgeoning Indiedom in a shrink-wrapped package.
12. But it had better be Tombstone and not one of those shrink-wrapped numbers from the deli department.
13. But he reckons that a company using Advance would save 25% on buying and implementing a shrink-wrapped product itself.
14. Although there have been cases of viruses spreading on shrink-wrapped software, these are relatively rare.
15. It is also a new type of standard contract at Internet times. The rise of the shrink-wrap contract challenges the traditional contract law.
16. In the second chapter, the author puts forward some question about the shrink-wrap contract.
17. According to the company, this can undertake between 50-60 cases or shrink-wrap collations a minute.
18. Instead, nanoHUB resizes the X11 frame buffer itself, and it allows the viewer's frame buffer to shrink-wrap the application to an appropriate size.
19. The printed substrates have images which are stable even when subjected to the heat and abrasion from a process which provides a shrink-wrap over the printed substrate.
20. One threat, as yet untested in the courts, comes from shrink-wrap licenses that explicitly prohibit anyone who opens or uses the software from reverse-engineering it, she says.
21. When it's cold out, cover your windows with plastic and shrink-wrap them by using a hairdryer to heat the plastic at its edges.
More similar words: shrink-wrappedshrinkshrinkingshrinkageshrinkableshrink fromshrinking violetshrineenshrineinkwellshriekshriftshrimpshrillshrikeshrivelshrillyshriekedwrapshrivel upshriveledshriekingshrillingrinky-dinkshrillnessshrivelledshrivelingwrapperenwrapunwrap
Total 21, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words