Sentencedict.com
 Directly to word page Vague search(google)
Home > Pac in a sentence

Pac in a sentence

  up(0)  down(0)
Sentence count:57Posted:2017-07-27Updated:2020-07-24
Similar words: pactpackpacespaceapacepacedpacifypack offMeaning: n. committee formed by a special-interest group to raise money for their favorite political candidates. 
Random good picture Not show
1 At the same time, San Francisco-based Pac Bell is gearing up to enter the long-distance market next year.
2 Adams was laid off his job at Pac Bell last August.
3 The specific proposals of the PAC were set out in paragraph 8.10 to 8.16.
4 Later this month Pac Bell will run ads in the L.
5 The companies, including Pac Bell, are eager to provide one-stop communications shopping to consumers.
6 A comrade had found a cave near Pac Bo, a village nestled amid the strange northern landscape of limestone hills.
7 Key Intel and Pac Bell executives could not be reached for comment Wednesday night.
8 The PAC said that de Klerk had not conceded enough to persuade the movement to bring its exiled cadres home.
9 Pac Bell has sought to make amends with the Stinsons by agreeing to pay their cellular phone bill.
10 As a goodwill gesture, Pac Bell sent baskets of fruit to competitors welcoming them to the market.
11 The McHugh and Conable bill left PAC and candidate spending untouched.
12 Thomas Bliley, R-Va., has received the most tobacco PAC money in the past decade, $ 123, 976.
13 They return to Pac Bell today after a two-game road trip.
14 Macrophages are something like a cross between a Pac Man and a vacuum cleaner.
15 PAC Worldwide is a manufacturer of protective packaging.
16 Ultrafiltration combined with PAC could enhance removing organics effectively.
17 Packaging Aids Corp. (PAC) manufactures heat sealing equipment for the food, medical, industrial, and electronic industries.
18 So exploiting new function of food packaging, green packaging which can reduce pollution produced by its castoff became current of food pac...
19 Guide PAC - MAN through four vast , scrolling 3 D mazes, whilst chomping dots and evading ghosts.
20 Conclusion The baculovirus expression vector pAC - HBs - Fc for complete IgG antibody against HBsAg was successfully constructed.
21 You stayed home and played Ms. Pac - Man while l went to work like a chump?
22 The goal is to customize content for a California audience, a feature that Pac Bell hopes will give it an edge.
23 Indeed, none of the small-business groups comes close to perennial PAC powerhouses such as the National Association of Realtors.
24 In 1989, Adams launched his cartoon while still working at Pac Bell.
25 That would allow them to resell the lines to customers in competition with Pac Bell and each other.
26 Ascend recently struck a deal to sell equipment to Pac Bell.
27 A Senate candidate can accept up to $ 10,(www.Sentencedict.com) 000 from a single PAC during a six-year election cycle.
28 Acid - leaching reactor is the key instrument for preparing poly aluminium chloride ( PAC ) from kaoline.
29 Objective To investigate the decreasing blood lipids effect of pilose antler capsule ( PAC ) .
30 Objective: The paper contrasts flocculation with property between the synthesis polyaluminium chloride ( PAC ) and sold PAC.
More similar words: pactpackpacespaceapacepacedpacifypack offpace outunpackcompactpacingoutpacepackedpacketimpactpack uppapacyprepackopacitypacificpackingpack icepackagepacifismpacifistrapacityspaciouspackagedpacifier
Total 57, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words