Sentencedict.com
 Directly to word page Vague search(google)
Home > Eight in a sentence

Eight in a sentence

  up(1)  down(1)
Sentence count:229+71Posted:2017-03-05Updated:2020-07-24
Synonym: 8Ashcan SchoolEightVIIIeightereighter from DecaturoctadoctetoctonaryogdoadviiiSimilar words: heightweighteightyeighthfreightsleighteighteenput on weightMeaning: [eɪt]  n. 1. the cardinal number that is the sum of seven and one 2. a group of United States painters founded in 1907 and noted for their realistic depictions of sordid aspects of city life. adj. being one more than seven. 
Random good picture Not show
211, Laplace at seventy - eight died young. He was still unsatisfied, still sure that he had a lot to learn.
212, They are constructed of building blocks of protein and eight different monosaccharide sugars.
213, This paper deals with leaf anatomy of 33 species in eight subgenus of Rhododendron from China.
214, At the Grammy's, eight seems to be the magic number.
215, Tensions on the Korean peninsula have pushed South Korea's currency, the won, to an eight - month low.
216, Airtight control technology, automatic lockout nutrition. Eight heavy safekeepings of security, many kinds of menu selections.
217, Laplace, the astronomer , was still at work when death caught up with him at seventy - eight.
218, The economy has grown at more than eight percent a year during Nestor Kirchner's presidency.
219, Mr Manson Mingott had died when she was only twenty - eight .
220, Travelling just 60 miles drive from the capital, Kinshasa(sentencedict.com/eight.html), can take about eight hours.
221, I was assigned the lobster shift, from midnight until eight in the morning.
222, Twenty - eight Dutch hospitals recruited patients with uterine fibroids and menorrhagia, who were eligible for hysterectomy.
223, The country has now spent more than eight years under martial law.
224, Landslip and Flood Warnings were also issued on two and eight occasions respectively.
225, Mercer will have his jaw wired up tomorrow and will be sidelined for six to eight weeks.
226, A woman in Niger , where many infants are already malnourished, can expect to have eight children.
227, We shall never get eight of us in the car, leave alone the bags and boxes.
228, Slumdog Millionaire, which won eight Oscars across mainland China from tomorrow.
229, And, yes, they've earned bowl berths in each of Leach's eight seasons.
More similar words: heightweighteightyeighthfreightsleighteighteenput on weightweightlifterhighlightneighweighneighborweighingneighboringneighborhoodbightsightfightlightnightrightmightslightblightflightmightyplightknightall right
Total 229, 30 Per page  8/8  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words