Sentencedict.com
 Directly to word page Vague search(google)
Home > Billing in a sentence

Billing in a sentence

  up(0)  down(0)
Sentence count:142Posted:2017-06-12Updated:2020-07-24
Similar words: fillingwillingmillingspillingdrillingshillingchillingthrillingMeaning: ['bɪlɪŋ]  n. request for payment of a debt. 
Random good picture Not show
121. Loeb pioneered the use of credit card billing statements as a vehicle for magazine sales.
122. This would require billing support from API vendors to chargeback for excessive use by a customer but it would work.
123. The design of real- time billing engine of BIMS is discussed in the paper in detail.
124. Follow up network query to ensure the billing issues are solved quickly.
125. GPRS features with high-speed transmission, always-on-line, billing by flow, automatic voice data switch, fast login, etc. It drives mobile Internet to enter commercial stage.
126. To define an appropriate implement process of data real-time collection and manual backup is an important task for the telecommunication company to carry out centralized billing for toll call.
127. To her surprise, the photos won her top billing as "Forum Beauty". She was thrilled to be appreciated by strangers for the first time in her life.
128. Fast developing telecommunication industry requires excellent management and billing system , country.
129. Make sure all the checkouts with balance have supporting document for billing.
130. All those service use the same billing system and the same OAM system.
131. This level also responsible for ensuring the appropriate billing of users.
132. Billing is based on successful placement and fees will be invoiced when the short listed candidate accepts the offer and upon signing of contract.
133. In this example[sentencedict.com], we examine how a company uses business rules to define the billing rules and to externalize and modify them on the fly.
134. This script language is used for telecom billing domain only, and supports data types related to billing and basic statement types. This language also provides some internal functions for billing.
135. It's a fixed bar code scanner market ranking, the billing system market.
136. BAS ( Building Automation System ) includes central air - coon , cooling unit, water supply and discharge ... distribution, public area lighting, elevator, billing systems.
137. Billing system for telephone station 2 N, LG complete source code, has been tested.
138. And, the medical field is a big driver of this trend – programs for certification as a medical assistant or a medical billing and coding specialist have seen growth in recent years.
139. Junctor Trunk Group is a special-purpose trunk group providing a particular feature such as coin control, billing supervision, etc.
139. Sentencedict.com is a online sentence dictionary, on which you can find nice sentences for a large number of words.
140. While Mickey Mouse often enjoys top billing in the US, in much of Europe - especially among Germans - it is Donald Duck who is the undisputed star.
141. Please provide us with a current catalog, price list, information regarding your billing procedures and a credit application.
142. Secondary service models are in progress, and many have standardized billing and metering models that have gained acceptance in all levels of business.
More similar words: fillingwillingmillingspillingdrillingshillingchillingthrillingwillinglyfulfillingwillingnessunwillinglyrolling millbe willing tounwillingnessbillionbilliardbillionairefill inillinoisbill clintonsillinesspenicillinbillowinggallingcallingfallingbilingualpullingstalling
Total 142, 30 Per page  5/5  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words