Sentencedict.com
 Directly to word page Vague search(google)
Home > Swarm in a sentence

Swarm in a sentence

  up(5)  down(6)
Sentence count:168+4Posted:2017-04-01Updated:2020-07-24
Synonym: assembleclustercollectcrowdgathermeetthrongSimilar words: swarmingswarthywarmwarmlywarmthwarm uplukewarmglobal warmingMeaning: [swɔrm /swɔːm]  n. 1. a moving crowd 2. a group of many insects. v. 1. be teeming, be abuzz 2. move in large numbers. 
Random good picture Not show
61. Africanized honeybees swarm toward an Ochroma flower just after sunset.
62. An algorithm for discretization based on Particle swarm optimization (PSO) is presented, which can settle the problem of continuous attributes discretization in systema modeling perfectly. ?
63. Within just a light-year of the black hole swarm more than 100,000 other stars caught far more firmly in its grip.
64. There used to be a swarm of these small apparitions, in holiday time; and we called them children of the Lord of Misrule.
65. At the same time the technique of immune PID and swarm optimization applies to hydraulic width control to improve the ability of the hydraulic width control system.
66. At the same time, in order to insure the calculability of the objective function in the searching process of the particle swarm,[http://sentencedict.com/swarm.html] neural network is used to model the voltage boosting circuit.
67. Compared with the real data, particle swarm neural network with sliding time window technique in modeling the mid and long term electric load is effective, and the model can meet the actual demands.
68. The bintree structure based on SA rule makes it more flexible and simple to control the robots swarm.
69. A swarm of planets absorbed most of the available angular momentum.
70. They have no real weakness, unless a swarm is placed on top of them, a mortar is launched their way or a rain of plasma falls on them from a Devastator.
71. Not even a swarm of flies disturbs a cheetah's after - dinner catnap.
72. The blast of the brightly-coloured plastic trumpet has been likened to an elephant or a swarm of angry bees. It will provide a discordant and ever-present backdrop to events on the pitch.
73. This paper presents a new polygonal approximation approach based on the particle swarm optimization ( PSO ) algorithm.
74. The results have shown the effectiveness of particle swarm optimisation for flexible job shop scheduling.
75. This young capybara was dragged into the water by a caiman, a local alligator. But now a swarm of piranhas is feasting on the prize.
76. Improved Particle Swarm Optimization is applied to short-term optimal scheduling of the cascade hydropower plants.
77. The results have shown the effectiveness of particle swarm optimization for flexible job shop scheduling.
78. And this mock-up shows how the swarm robots could actually operate together.
79. Finally,(Sentencedict.com) the proposed method is verified by the design process planning of a transmission. (2) We propose a Swarm Intelligent based Scatter Search method (SISS).
80. The locust swarm has destroyed all the crops and vegetables.
81. I've seen more than a few hives throwing off a swarm, and never has one failed to transfix me utterly, or to dumbfound everyone else within sight of it.
82. Thus, the high-temperature-loving microbes that swarm around deep-sea hydrothermal vents are often genetically and metabolically similar to the microbes in the hot springs of Yellowstone.
83. Each scout inspects the site she navigated to and if she agrees that is a desirable dwelling place, she too performs a waggle dance when she returns to the swarm.
84. A new improved discrete particle swarm optimization algorithm is designed to tackle the Traveling Salesman Problem.
85. The approach divided the exploring region into several sub-regions, and then used the particle swarm to depth-first search the sub-regions.
86. A method to evaluate spatial straightness errors adopting particle swarm optimization ( PSO ) is proposed.
87. Every so often a comet gets flung out of the Oort Cloud, a swarm of comets on the fringes of the solar system, and gets close enough to Earth for us to see it.
88. Particle swarm optimized particle filter (PSOPF) incorporates the newest observations into sampling process and also optimizes it.
89. This study trained them to swarm around the location of the scent of 2, 4-dinitrotoluene, a chemical residue left by several different types of bombs.
90. One day, as the herd funneled through a gully at the tree line, Karsten and Leanne spotted a wolf creeping up. The herd responded with a classic swarm defense.
More similar words: swarmingswarthywarmwarmlywarmthwarm uplukewarmglobal warmingbackwards and forwardsswayswapswagswanswathswampswatheswankyswallowswampyswastikaswaggerswampedcrosswalkswallowingswallow the baitaswan high damarmfarmarmsharm
Total 168, 30 Per page  3/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words