Sentencedict.com
 Directly to word page Vague search(google)
Home > Simplex in a sentence

Simplex in a sentence

  up(0)  down(0)
Sentence count:156Posted:2018-01-09Updated:2020-07-24
Similar words: herpes simplexsimplesimplersimpletonsimple sugarsimple-mindedpure and simplesimplemindedMeaning: ['sɪmpleks]  adj. 1. allowing communication in only one direction at a time, or in telegraphy allowing only one message over a line at a time 2. having only one part or element. 
Random good picture Not show
121 And it points out that a lot of troubles caused by bounded variables are solved through little changes of simplex tableau.
122 Compared with conventional Hill-climbing algorithm, a novel method for optical fiber alignment using Simplex Genetic Algorithm Hybrid (SGAH) is presented.
123 If you know some operation research theory, build the simplex tableau and check it out.
124 For systems with seals of lip ring type, simplex, etc. , LO in accordance with the attached LO list No. 483 to be used.
125 Participants were also tested for herpes simplex virus 1 (HSV-1), which causes most cold sores.
126 Two kinds of optimization method, Simplex method and Simulated annealing, are analyzed and compared.
127 Conclusions: The acupuncture therapy of reducing spleen and stomach can reduce weight and fat of adiposis simplex rats, and the effection is better than the other two methods.
128 An Indian scientist claims to have identified two plants in the Nilgiri hills that may contain a cure for life-threatening diseases caused by Herpes Simplex Virus.
129 Then the linear programming are solved by dual simplex method to get the solution of the original 2-dimentional second-order cone programming. Finally, some sensitivity analysis are made.
130 The esophageal squamous epithelium here is from a sharply demarcated "punched out" ulcer from Herpes simplex virus infection. Note the mauve to pink intranuclear inclusions.
131 MRI of herpes simplex encephalitis in them had its characteristic manifestation.
132 Terms like simplex (for one) and triplex (for three) indicate the number of cylinders a particular pump features.
133 The main contents of this course include linear programming(sentencedict.com), simplex arithmetic.
134 The product divides two person of operations and the simplex operation two varieties.
135 One - way simplex , two - way simplex, or duplex operation can be specified.
136 Objective To construct the DNA vaccine against type 2 herpes simplex virus(HSV-2) modified by ubiquitinated infectious cell protein 27(ICP27).
137 In order to solve linear programming problems,[Sentence dictionary] simplex method with bisection carries out pivoting operation on a series of sub-program.
138 A kind of simplex algorithm that its constringency coefficient and expanding coefficient are been changing appropriately in the process of searching optimization values is developed.
139 Objective : To identify gene mutation in a family with Weber - Cockayne type epidermolysis bullosa simplex ( WC - EBS ).
140 Telegraph repeater. One - way simplex , two - way simplex, or duplex operation can be specified.
141 The result shows the algorithm is effective and simpler than simplex algorithm.
142 It indicates that new exam mode not only conquers limitation of simplex close-exam, but also boosts forwardly study of students and promotes the didactical reform completely.
143 Many traditional single simplex communication devices now can act as a duplex system under the help of voice activated module, which is actual voice activity detector.
144 The survival strategy of herpes simplex virus centers on developing latent infection and periodic reactivation.
145 Viral encephalitis is a common cause of symptomatic epilepsy. The most frequent and serious epilepsy is generated by herpes simplex encephalitis.
146 Objective To explore the value of CT and MRI in the early diagnosis of acute type I Herpes simplex encephalitis (HSE).
147 So, simulated annealing and simplex combine to form a global hybrid method.
148 The answer is in the algebra behind the simplex algorithm, but explaining how it works is beyond the scope of this article.
149 Based on the principle of the dual simplex method about linear programming, the changes of the value of the objective function in iterations have been studied.
150 The paper developed a portable bearing fault detector with low cost, low power consumption and strong function to solve the problems like high price, simplex function and others.
More similar words: herpes simplexsimplesimplersimpletonsimple sugarsimple-mindedpure and simplesimplemindedsimple machinesimple interestsimple sentencecomplexsimplysimplifycomplexitycomplexionsimplifiedsimplicitysimplisticgolgi complexwimplepimpledimpleoversimplifydimpledpimpledcrimpleelectra complexoedipus complexcomplex sentence
Total 156, 30 Per page  5/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words