Sentencedict.com
 Directly to word page Vague search(google)
Home > Riser in a sentence

Riser in a sentence

  up(0)  down(0)
Sentence count:99+1Posted:2017-09-15Updated:2020-07-24
Similar words: risemiserwiserpriseariserisenkaisermiseryMeaning: ['raɪzə(r)]  n. 1. a person who rises (especially from bed) 2. a vertical pipe in a building 3. structural member consisting of the vertical part of a stair or step. 
Random good picture Not show
61 FCC performance of CHV 1, LV 23 and an imported catalyst was tested using XTL 5 riser pipe pilot plant.
62 According to gas velocity, gas-solid fluidization has been classified into low-speed riser, cocurrent downer and pneumatic fluidization)in this paper.
63 Enter target riser height to be used in calculating the number of risers.
64 Random vibration and offset of riser system in marine drilling under the random wave force, if terrible, may cause failure of drilling tools and break off of drilling.
65 Using a stencil I then draw out the shape of the riser.
66 A formulation to analyse the large displacement problem of a marine riser with two unequal principal moments of inertia of the cross section in the 3-D space is presented.
67 According to continuity law of hydrodynamics, theory equation between riser gas holdup and downcomer gas holdup in TBCR is derived, and value of the important parameter a in the equation is discussed.
68 So being the proactive goal - achiever I was, I set out to become a habitual early riser.
69 In the operation progress of offshore exploratory well, the strength and stability of drilling riser can play an important role in offshore drilling and completion.
70 The frontal riser of the first pediment surface (P1) is the most recent fault scarp or diluvial platform; at the foot of pediment P1 outcrops the fault.
71 The heat input of gasification using coalite as solid heat carrier comes from combustion heat of the solid heat carrier in riser.
72 Riser Pipe: A four-foot-diameter steel pipe called a riser connects the ship to the borehole.
73 Drilling riser is an essential device for Marine drilling operation, so its safety and reliability must be guaranteed. Vortex-induced Vibration (VIV) is ...
74 Feeding effect can be improved with qualified casting using side riser gating system for plate or heavy concave aluminum alloy casting.
75 The intensification of combustion process is first discussed. Then, the structure,[http://sentencedict.com/riser.html] test and application of low-pulsating riser pipe burner are described.
76 Strength and security of riser play an important role in offshore drilling and completion.
77 Considering large deformation and mud inside drilling riser, effects of top tension ratio(TTR) and vessel offset on internal force and deformation were studied.
78 The effect of the aeration to the pyrolysis chamber on the pressure distribution of the standpipe was more remarkable than on the riser.
79 The ideas for further development of the residuum catalytic cracking reaction technology according to the problems of commercial riser were discussed.
80 The basic theory and technical points of a new kind of lap gate(riser)adopted to produce iron castings of wheels are discussed and good economic results of this technology in product...
81 There is abnormal bottom shrinkage in Zn Al alloy castings and top riser has little effect on them.
82 Sand the riser area,[sentencedict.com] apply the CA glue to every surface.
83 Synopsis: This paper introduces the position and characteristics of the blow hole shrinkage in the side riser of cast steel castings and probes into the formation mechanism and its prevention.
84 The ratio of downcomer to riser cross sectional area, the bottom clearance and the ratio of height to diameter of the reactor are proved to be important of the cell growth behavior.
85 Back in the yard, Michael sits on the top riser of the bleachers, directly above the bolt.
86 DW goes base line riser, yeah, that's a big time player make a big time shot.
87 The gas - solid heat transfer coefficient will decrease when height of riser increases.
88 Shares in ARM were up 3.1 percent at 399.7pence by 0817 GMT, the top riser in the FTSE 100 index (.FTSE), and setting aeight-year high for the second consecutive day.
89 An internal airlift loop reactor(ALR) is built , with air- water two - phase mode as the object of study, a manometric method is used to determine the gas holdup in the riser and downcomer.
90 After canceling the cold riser the shrinkage problem was successfully solved.
More similar words: risemiserwiserpriseariserisenkaisermiseryrise uparisencerisecrisesupriseirisedbruiseradvisermiserlydevisercruiserreprisephariseesunrisecompriseon the riseapprisesurprisehigh-risevaporisepolarisememorise
Total 99, 30 Per page  3/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words