Sentencedict.com
 Directly to word page Vague search(google)
Home > Riser in a sentence

Riser in a sentence

  up(0)  down(0)
Sentence count:99+1Posted:2017-09-15Updated:2020-07-24
Similar words: risemiserwiserpriseariserisenkaisermiseryMeaning: ['raɪzə(r)]  n. 1. a person who rises (especially from bed) 2. a vertical pipe in a building 3. structural member consisting of the vertical part of a stair or step. 
Random good picture Not show
31 A telescoping joint at the surface in floating offshore operations that permits vessel heave (vertical motion) while maintaining a riser pipe to the seafloor.
32 Note: Riser Pipe & Sleeve Pipe are the same length.
33 Move the BOP to the moonpool door and attach the marine riser.
34 The velocity transient signals of particles in riser a laser Doppler velometer.
35 The exothermic riser head which uses the LYH-3 dextrin as binder is superior to enhance and make the best of the thermal efficiency for the casting shrinks.
36 Efforts will now focus on severing the damaged riser pipes that lay crumpled on the ocean floor, then installing a containment device that could capture the leaking oil and syphon it to the surface.
37 The shrinkage reason of roller neck connecting with riser was analyzed.
38 The differential equation for the vibration of the riser system is derived by means of functional calculus of variation.
39 I figured I must have been born without the early riser gene.
40 By comparison of five kinds of riser, the paper recomends the casting process design of side-blind riser which can assure the casting quality and reduce the casting cost.
41 According to conventional sequence solidification principles, de-signing riser size of heavy castings by proportionally magnifying the heat center circle is wrong.
42 The technology is equipped with a catalyst mixer at the bottom of the riser, which can produce an ideal circular flow of catalyst before the catalyst contacts with the feed oil.
43 The water flow velocity in the suction pipe, which is crucial for evaluating the performance on pumping fish, can be measured by the pumped water flow rate of the riser in an air lift pump system.
44 The flux in the riser reactor is close to plug flow, which greatly demotes the back mixing.
44 Sentencedict.com is a online sentence dictionary, on which you can find excellent sentences for a large number of words.
45 During the process of Weizhou12-1B Oilfield we ll drilling, downhole instance is complexity, and drilling time is longer, so drilling riser pipe has to have a good depth stability.
46 The results show that the radial distribution of particle velocities always becomes less uniform along the riser height and finally reaches a parabolic profile in the upper section.
47 Macro-segregation of a steel ingot in a rectangular mold with a riser was simulated and the calculation result was compared with that of an experiment.
48 Utilizing peculiarities of platform cluster well groups the cross operation technique of riser pipe, surface and oil formation is executed to improve drilling efficiencies.
49 It shows that the modal shape and mode frequency are highly coupled with the VIV response of a marine riser with low mass ratio.
50 Check point should be set on water drainage riser each level. It should be set at lowest level and highest level which has sanitary fittings.
51 The drift flux model was used to study gas hold-up in riser.
52 Remote-controlled machines smash the sulfide deposits, which are then hoovered up through a riser pipe to a vessel on the surface.
53 Engineers will now lower a containment cap to the seabed and attempt to fit it over what's left of the riser pipe.
54 A rectangular clear box features as a product riser for show window display purpose. A number of elements put together can form different height and shape for various display needs.
55 According to the results and combining with theoretical analysis, the casting process was improved by increasing the size of riser neck and chills and adding the number of the riser.
56 The results show that the gating and feeding system without riser is reliable through calculating the sizes of gating system by moduli calculation method.
57 The test results show that by controlling the T-junction and riser tube's resistance coefficients, the unbalanced riser flow distribution has been achieved.
58 I use smooth - on epoxy to glue the riser and the limbs.
59 Vibration and offset of riser system in marine drilling under the alternating action of wave force, if terrible, may cause failure of drilling tools and break-off of drilling.
60 It has been found out that the defect was caused by adopting the foundry method with a cold riser which actually acted as a cold metal bleeder.
More similar words: risemiserwiserpriseariserisenkaisermiseryrise uparisencerisecrisesupriseirisedbruiseradvisermiserlydevisercruiserreprisephariseesunrisecompriseon the riseapprisesurprisehigh-risevaporisepolarisememorise
Total 99, 30 Per page  2/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words