Sentencedict.com
 Directly to word page Vague search(google)
Home > Ginkgo in a sentence

Ginkgo in a sentence

  up(0)  down(0)
Sentence count:107Posted:2017-08-04Updated:2020-07-24
Similar words: thank Godthank goodnessrinky-dinkinkkinkwinkrinkdinkMeaning: ['gɪŋkəʊ]  n. deciduous dioecious Chinese tree having fan-shaped leaves and fleshy yellow seeds; exists almost exclusively in cultivation especially as an ornamental street tree. 
Random good picture Not show
(31) He said: "We believe that some herbs, for example St John's wort, are linked to a higher risk of seizures, but there is still not a great deal of evidence about problems related to ginkgo."
(32) In this paper the suitable ecological conditions for the leaf bud of ginkgo to take roots are probed by the cuttage test of simple and fascicular leaf buds of ginkgo.
(33) Leading memory experts, however, are skeptical about ginkgo and other brain boosters.
(34) The results showed that: divinylbenzene and ethanol could not be determined, ginkgo acid content met the requirement of pharmacopoeia.
(35) This prompt care effects of Ginkgo biloba tea cardiac cerebral disease.
(36) Ingredient: Ginkgo, Tanshinone, Honeysuckle, Azaleas and Aloes Extract, Amino Acid Cleanser Factor.
(37) Consider ginkgo as part of your plan to overcome male sexual dysfunction.
(38) Ginkgo biloba on the skin, the stratum corneum is obvious.
(39) Ginkgo biloba is the sole survival plant and famous local economic species in China with an aggregative function of fruit, foliage, timber, ornamental, ecology and shelterbelt .
(40) Objective:To study the effect of Ginkgo biloba exocarp polysaccharides(GBEP) on HL-60 cells in vitro.
(41) The sanitarian function of the goods of ginkgo is better! See relevant specification can. The comparison of natural green is good!
(42) The sanitarian function of the goods of ginkgo is better!
(43) Taken as a maintenance supplement, it works synergistically with other "smart nutrients" like Ginkgo Biloba, GABA, Phosphatidyl Serine and L-Tyrosine,(sentencedict.com) or can be taken alone.
(44) Every M 3 already exceeded 3000 dollars on ginkgo lumber international market.
(45) Ginkgo leaf shape has also been Geranyl on both sides of the sub - point of impact.
(46) But research on microstructure changes of etiolated ginkgo leaves under white and blue light treatment showed that chloroplast had formed and there had some stroma lamella in it.
(47) The etiolation symptom of the ginkgo leaf can be effective meliorated by using HAF.
(48) The ecological environment quality fo Ginkgo biloba GAP base was monitored soil , water and air etc.
(49) Objective : To study the preparation process of compound ginkgo biloba injection and hemolysis test.
(50) For functional polymer of rosin allyl alcohol ester, the static adsorption of ginkgo biloba flavone was 22.
(51) The induction of calli on different explants of Ginkgo biloba and the determination of the flavonol glycosides from its callus by high-performance liquid chromatography (HPLC) were studied.
(52) West Valley Road change beautiful double, four lane highway into six lane widening, hundreds of trees and more than 100 lanterns Chinese Lantern Ginkgo trees off the street was very brilliant.
(53) Ginkgo biloba, also known as ginkgo is the oldest existing plant seeds of the relict plant.
(54) This study was aiming to investigate the effects of Ginkgo biloba extract (GBE) on free radicals of different fibre types of quadriceps in rats by electron spin resonance (ESR).
(55) I quietly that a place such as ginkgo biloba, green earth.
(56) Varieties include ginger, ginkgo biloba, ginseng, hibiscus, jasmine, rosehip, mint, rooibos (red tea), chamomile, and echinacea.
(56) Sentencedict.com is a sentence dictionary, on which you can find nice sentences for a large number of words.
(57) Objective: To observe the efficacy of combination of Ginkgo bilobate extract and 654-2 on treatment of diabetes peripheral nervous disease(DPND).
(58) Extraction and analytical methods of flavones from Ginkgo biloba leaves are reviewed.
(59) Extracts of ginkgo biloba are among the most widely used dietary supplements.
(60) Objective : To observe the effects of Ginkgo Dew on cough, gasp caused by acute or chronic bronchitis.
More similar words: thank Godthank goodnessrinky-dinkinkkinkwinkrinkdinksinkminkpinkjinklinkfinkdinkyinklelinksblinkbrinkdrinkkinkystinkchinkslinkthinkin kindstinkytinkertinklelink up
Total 107, 30 Per page  2/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words