Sentencedict.com
 Directly to word page Vague search(google)
Home > Extensively in a sentence

Extensively in a sentence

  up(1)  down(4)
Sentence count:213+10Posted:2017-07-05Updated:2020-07-24
Similar words: extensiveintensivelypensivelydefensivelycomprehensivelyapprehensivelyextensionintensiveMeaning: adv. in a widespread way. 
Random good picture Not show
181. The nylon has extensively been used for replacing the cotton now.
182. Dr Moll had an extensive problem on his hands, it turned out, called extensively drug-resistant tuberculosis, or XDR-TB.
183. The product has also been used extensively for coffer damming in civil engineering work.
184. BaTiO3 is one of most widely used ferroelectric materials and has been extensively studied.
185. The building also used reclaimed materials extensively, including siding from a barn.
186. This secret was extensively used by President Woodrow Wilson, during the World War.
187. Used the truth displaying the national life activity extensively with personal unique visual angle and judgement.
188. With the rapid development of science and technology in the 21st century, English is as a kind of information interchange and language tool used extensively, and paid more and more attention to.
189. But I still believe that political assassination can be said to be practised very extensively.
190. At present, full radius hob is used extensively for heavy transmission gear production.
191. The ground-based radar at various band and optical system have been used extensively to measure and investigate the meteor event.
192. The axiomatic method is a mathematics method from geometry, owing to the outstanding characteristic, it is getting a scientific method used extensively.
193. You apply contracts extensively in the code, but then you disable contracts at the assembly level.
194. Paul Graham has written extensively about this so I won't belabor it too much, except to say this: you don't need much startup capital, but what you do need is a willingness to work your buns off.
195. Then the research work emphasized on the description of the sliding mode surface, sliding mode condition and chattering is surveyed extensively.
196. Archaean era granulite facies metamorphite series are extensively outcropped in Sa - heqiao,[sentencedict.com] Hebei province.
197. The term of the most closed contact principle, extensively adopted in the conflict of laws, is initially used in the violation of the overseas laws.
198. International check organization and quality department appoint to adopt TILO brand extensively, have had as many as ten thousand domestic and international high-quality travelling traders.
199. By reading novum organum extensively, we found that his thought showed a tendency of ontology of language.
200. Now, the extensively used method to destroy trinitrotoluene nitronaphthalene explosives is to burn them in an out-door field. Serious pollution will be introduced in this way.
201. Paralanguage , including body language, has been extensively studied in social psychology.
202. The bar code technology was applied in purchasing management. The coding purchasing information system was designed with the code 39, which was applied in the area of industry extensively.
203. It has been extensively applied in animal feed. High dose copper not only affects production quality of animal but also causes copper poisoning, which is characterized by haematolysis.
204. Ion beam induced surface modification of polymer was extensively discussed.
205. MHC genes are extensively investigated as candidate genes for disease resistance in many domestic animal species, which is a hot topic in molecule immunogenetics.
206. So the composite structure of concrete has been used extensively in various engineering in these years.
207. The originally dynamoelectric liquid press type butter notes oil machine to used for to the mineral mountain extensively.
208. Stepper motor is extensively applied in low precision position servo system with open loop control.
208. Sentencedict.com is a sentence dictionary, on which you can find excellent sentences for a large number of words.
209. Soapnuts are used extensively in some countries for washing woolens and delicates.
210. First, we describe material domain Structure, and then, by connecting it with the practical process for manufacturing materials, we evaluate extensively the magnetic Orientation methods.
More similar words: extensiveintensivelypensivelydefensivelycomprehensivelyapprehensivelyextensionintensiveexpansivelysensitivelyintensive cultivationpensiveoffensiveexpensivedefensivepassivelymassivelyevasivelyderisivelyabrasivelydecisivelyinexpensivecompulsivelyobsessivelyimpulsivelysubmissivelyexclusivelyimpassivelyexcessivelypersuasively
Total 213, 30 Per page  7/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words