Sentencedict.com
 Directly to word page Vague search(google)
Home > Mapped in a sentence

Mapped in a sentence

  up(0)  down(0)
Sentence count:222+7Posted:2017-11-08Updated:2020-07-24
Similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendix
Random good picture Not show
(61) He mapped the glottochronology of the romance languages.
(62) They mapped the South Pole.
(63) The client's user ID and password for accessing the federated database is mapped to a remote user ID and password.
(64) Studies on allelism were analyzed among the ID24, 810S and M61S. The tms gene in ID24 was mapped using SSR markers.
(65) For instance an element/attribute of type integer can be mapped to a column of type character.
(66) A simple example is that of an LDAP search request being mapped to a JNDI search operation.
(67) Globalized data is represented using coded character sets called as code pages where the data is mapped to bit patterns.
(68) It is one of two natural islands dividing the Seine and is an example of some of the first attempts at urban planning as it was mapped out from end to end which is apparent when you see it.
(69) Baseball stadiums are also currently being mapped in 3D and are due to be available on the site in time for the start of the new baseball season April 1st.
(70) Researchers just mapped the genome of a female platypus from Australia.
(70) Sentencedict.com is a online sentence dictionary, on which you can find good sentences for a large number of words.
(71) In this method, the quantified subtargets are mapped to loop structures, in which each index variable tries to go through the variation domain of the corresponding quantified variable.
(72) The sequential process of SI is, at the macro-level, mapped onto three major linear phases: speech comprehension, concept shifting and output production.
(73) Boolean data type of Java is mapped to integer data type of ProbeVue with value 1 for true and value 0 for false.
(74) Each entity set is mapped to a separate table in the storage model.
(75) Performance counters use a memory mapped file, or shared memory, to publish performance data.
(76) The problem of plates layout can be mapped into an encasement problem.
(77) As mentioned above, the edge of mapped memory -- last valid address -- is often known as the system break or the current break.
(78) When a DLL is loaded, it is mapped into the address space of the calling process.
(79) IDEO then mapped the complex system from the patient's point of view recreating patient and family journeys that ranged from a simple physician consultation to open-heart surgery .
(80) Researchers mapped the basic genetic code for rice several years ago.
(81) Mapped the FIR digital filter design of amplitude frequency characteristic curve.
(82) Unlike an individual resource requirement, it did not matter whether the resource type was set to Staff or not; both tasks were mapped to tasks with work assignment set to Reviewer.
(83) Once all of the push-down methods are mapped for a CMP/A bean, emit the UDPDMI for that bean, so that the deployer can fill this in with the appropriate logic.
(84) Represents the permissions that can be granted for file access and operations on memory - mapped files.
(85) After you have successfully mapped every repository user to a CM user, you also have to do the same reversely.
(86) Lunar Prospector mapped the Moon's surface composition, gravity and magnetic fields.
(87) For a simple type, the Java exception name is mapped from the name attribute of the wsdl:message element.
(88) To test this feature, transfer a large file from AIX to the Windows client through a mapped drive.
(89) If new standards exist, data should be mapped to those new standards through mapping values, against a lookup table, or based on a defined pattern or algorithm.
(90) There were duplicated loci for 8 markers, and 7 markers that linked to one of markers in a linkage group but couldn't be mapped into that group.
More similar words: gappedtappedcappednappedwrappedtrappedchappedvermiform appendixuntappedstrappedwrapped upsnow-cappedunwrappedkidnappedsnowcappedhandicappedwhippersnappermappingmap projectionrippedpoppeddippedtoppedtippedclippedcroppedsteppedwhippedchoppedstopped
Total 222, 30 Per page  3/8  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words