Sentencedict.com
 Directly to word page Vague search(google)
Home > Drilling in a sentence

Drilling in a sentence

  up(0)  down(2)
Sentence count:195+5Posted:2017-06-04Updated:2020-07-24
Similar words: thrillingfillingwillingmillingchillingshillingspillingwillinglyMeaning: ['drɪlɪŋ]  n. 1. the act of drilling 2. the act of drilling a hole in the earth in the hope of producing petroleum. 
Random good picture Not show
121. During drilling, the positive colloidal solution is adopted to adjust the drilling fluid density dynamically, to ensure drilling at near balance pressure.
122. The certain placement of seed at the 12 - 20 mm level necessitates drilling rather than broadcasting.
123. This product sagely and effectively breaks conventional drilling mud, workover and completion polymers.
124. CASTON has experts from Xuanhua machinery plant with superiority down - the - hole drilling tool and anchorage drill pipe.
125. Advances in polycrystalline diamond compact( PDC) bits have sharply increased rate of penetration( ROP), reduced drilling time and costs in oil and gas wells.
126. Drilling rate should be based on the current changes and timely adjust.
127. Stones drilling bit: Use for drilling stones, concrete, firebrick etc.
128. Similar to the option to drill down by SQL statement, another way of drilling down to get the performance statistics is to drill down by transaction time.
129. The North Greenland Eemian Ice Drilling (NEEM) project reached bedrock in July 2010, at a depth of more than 2, 500 metres.
130. A portable torsional vane shear device has been developed to meet the needs of research work in marine geology, river exploration, geotechnics, oil drilling and soil mechanics.
131. In addition, anticipating market developments, Huisman develops special concepts as the containerized drilling unit.
132. In contrast , densimeter while drilling can overcome those defects by getting continuous and objective data.
133. To increase drilling weights in drilling, may effective1y raise the rate of penetration.
134. As for drilling mud but made up with 35 ppb Bentonite to 100 + vis.
135. This diagnosis has since been confirmed by deep - sea drilling.
136. This paper introduces the viscosity-reducing ability of new viscosity-reducing agent LGV in drilling fluid and preliminarily inquires into the action mechanism of LGV.
137. And we have CNC, CJK, Punch press, high-frequency heating machine, argon arc welding machine , drilling machine....
138. The air screw drill tool was power equipment which was designed for air drilling.
139. Although the risks of offshore drilling are much harder to quantify than the benefits, I believe the shift in the benefit-cost ratio has been large enough so that the time has come to allow drilling.
140. The major components of the rap oil seedcakes are protein, nitrogen-free lixivium , coarse fiber, crude fats, and ash content. These components have good filtration reduction in drilling fluids.
141. These new equipments can bring higher drilling rate, lower drilling cost and remarkable economy benefits.
142. To develop and produce the latest model, high performance, low, open-air pit for various models of drilling machinery, while the supply of accessories.
143. But, it is very necessary that terminal fans is included in the depositional models by field and drilling data.
144. Applicable to the valves, flange, the spherical bearing, such as the need to drill porous drilling processes using mechanical parts.
144. Sentencedict.com try its best to gather and create good sentences.
145. The drilling in sulphide mounds at the ocean bottom and their comparison with VMS (volcanogenic massive sulfide) indicate that they have similar internal structures and mineral zonation.
146. The primary function of the drawworks is to reel out and reel in the drilling line, a large diameter wire rope, in a controlled fashion.
147. Cutting head drilling rate is chosen as the aim of optimal design.
148. The mechanisms and characteristics for the polyglycol - based drilling fluid have been reviewed.
149. Oil drilling project is a special project which take the ground as the work object and has the high investment, high risks and high levels character.
150. These factors, which include slurrys preparation, circulation, depuration and so on, would influence drilling speed, bore quality, exertion of pile shaft resistance and base resistance.
More similar words: thrillingfillingwillingmillingchillingshillingspillingwillinglyfulfillingrolling millwillingnessunwillinglybe willing todrillunwillingnessmandrillfire drillquadrillebrilliantbrilliancebrilliantlyfill inillinoissillinesspenicillindrizzlingdribblingtrilingualgallingcalling
Total 195, 30 Per page  5/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words