Sentencedict.com
 Directly to word page Vague search(google)
Home > SPI in a sentence

SPI in a sentence

  up(0)  down(0)
Sentence count:35Posted:2018-03-11Updated:2020-07-24
Similar words: spitspivspicspinspiffaspicspicyspile
Random good picture Not show
1) This paper introduces a data collector based on SPI bus which applies TLC2543C serial A/D conversion chip and gives out the timing diagram of TLC2543C and the flow chart of the collector.
2) In this paper, the graft copolymerization of SPI with vinyl acetic ester (VAc) was initiatively studied.
3) With an increase of SPI content, the interactions among components change, resulting in various micro-structure of the complex microspheres.
4) It is very convenient to use serial peripheral interface (SPI) technology in the application of interface between highspeed serial A/D converter AD788 and AVR chip AT90S8515.
5) Objective To investigate the analgesic effect of saponin of Pterocarpus Indicus(SPI).
6) Objective To investigate the diagnosis value of electronic colposcopy for cervical subclinical human papillomavirus infection (SPI), and its concordance with pathologic diagnosis.
7) 0.01 ), spi - nach, cole, cabbage, ascorbic acid, cysteineand egg white ( P & lt ; ...
8) The aggregation of the hydrolysates of soy protein isolate(SPI) induced by subtilisin protease was investigated.
9) For communication within a PCB (printed circuit board), common options include the serial peripheral interface (SPI) bus and inter-integrated circuit (I2C) bus.
10) Single-chip microcomputer system includes the MSP430 processor, SPI interface, True RMS converter chip AD536, ADC AD7711, brown-out protection and reduction, as well as show circuit.
11) In this paper, the authors use SPI calculus to analyze the demand loading code protocol of active network. The security flaw of being replay attack in this protocol is found.
12) The behavior of aggregation of soy protein isolate (SPI) induced by Subtilisin protease was investigated.
13) My goal is to McBSP configured as SPI - compatible interface.
14) The enhanced SPI TMS320F2812, the newest fixed point 32bit DSP of TI, features few hardware requirement, high speed operation, flexible in configuration and continuous performance.
15) This thesis studies biodegradable materials which are made from modified soybean protein isolate(SPI) by acetylate and glycerin.
16) The serial peripheral interface ( SPI ) is a standard communication protocol, which is used in many fields.
17) Advanced manufacturing requires relevant production information model, which is divided into the structured product information (SPI) and the non structured product information (NSPI).
18) The results showed that the ironabsorption was enhanced by orange, citrus, actinidia chinensis pianch ( P & lt; 0.01 ), spi - ...
19) This interface can be used to data exchange with peripheral apparatus for processor and controller which have not SPI interface function.
20) "Some time next year, supply/demand and pricing in DRAM will deteriorate, probably around the fourth quarter in 2010," said Yoshihiro Shimada, chief analyst at SPI (A)nalysis in Tokyo.
21) Methods Analyze the hiding mechanism of new Trojan proceeding from the principle of SPI technique and excogitate a method to check and clean this type of Trojan accordingly.
22) The STHR01 is a MCU based temperature and relative humidity sensor module, comprising a SPI interface (master mode) for direct temperature and humidity read out.
23) The use of multi-channel buffered serial port MCBSP is to achieve SPI bus (mode of) data collection, and the real-time data transmission and storage is achieved by the use of two DMA controllers .
24) Customers can achieve higher frame rates for the sensor with windowed or sub-sampled readout modes, and can program the sensor's settings over an SPI interface.
25) Papain and chymopapain can coagulate soybean protein isolate ( SPI ) , both of them are cysteine proteinases.
26) The article introduces its structure, property, feature and analyzes the design method of it and SPI. The present application note describes an example of controlling a 4-bit LED using SPI.
27) If SS is an input and is driven low when the SPI is in Master mode, this will also set the SPIF Flag.
28) C 8051 F based on the use of single - chip SPI interface software reference design.
29) No bones,[http://sentencedict.com/SPI.html] not even a camo panel from a suit of SPI armor.
30) SPI communication between microprocessor and A/D module is realized by using serial peripheral interface module SPI of MC68HC908GZ60 microprocessor.
More similar words: spitspivspicspinspiffaspicspicyspilespielspikyspigotspikespickspiltspirespicehispidspillspirtspitespinyspinespiffyspiritsspinetspiderspiralespialwaspishspit out
Total 35, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words