Sentencedict.com
 Directly to word page Vague search(google)
Home > Slicing in a sentence

Slicing in a sentence

  up(1)  down(0)
Sentence count:91Posted:2017-09-17Updated:2020-07-24
Similar words: public interesticingdicingpricingenticingsluicingrejoicingservicingMeaning: [slaɪs]  n. 1. a golf shot that curves to the right for a right-handed golfer 2. the act of cutting into slices. 
Random good picture Not show
31. Slicing machine, sheet length and the number of precision.
32. The wind was slicing through his overcoat.
33. He is good at slicing the ball like that.
34. I'm used to it from slicing in the shop.
35. Eat a mango. According to Japanese researchers, the simple act of peeling, slicing and eating a mango, which contains a compound called linalool, could help you chill out faster.
36. The little boy had some trouble in slicing the orange.
37. Vertical slicing by filled stopes method is effective to mine fracturing ore body with the roof of moderate inclination.
38. Its definition and correctness proofs are provided in this paper. This paper also gives and illustrates dynamic slicing algorithm based on modular monadic sem...
39. Produce superb Web graphics using symbols and innovative slicing options.
40. The enzyme, which they named FAN1, appears to be a nuclease, which is capable of slicing through strands of DNA.
41. Slicing can be a useful tool when you want to make compositions.
42. What is the difference between preemptive scheduling and time slicing?
43. By the research of program analysis and slicing, the paper finds ways to solve some problems in aspect-oriented program analysis and structural testing.
44. The stormy petrel soars with a scream, a streak of black lightning, as an arrow pierces the clouds, on wing-tip slicing the wave froth.
45. Maybe we aren't a team that is just running and slicing and dicing and cutting.
46. This machine is mostly used for the machine serially foaming unlimited long slicing of foam rubber.
47. When I help my mother in the kitchen,(sentencedict.com) I always pull the strings out before slicing celery.
48. Dynamic priority adjustments and time slicing can happen at unpredictable times.
49. The CAD technology in micromachine rapid prototyping system is presented. The design of the slicing software for micromachine rapid prototyping system is discussed in detail.
50. This machine is mostly used for foam rubber's upright slicing and moulded slicing work.
51. Slicing is so much easier with a backhand ( shot ) .
52. And you access all the items in the same way using the square bracket operator,[www.Sentencedict.com] which supports slicing different types of sequential items.
53. This utility uses slicing to delete entries in the audit log table; that is, only the specified number of entries are deleted in a series of single transactions.
54. So, now, similarly, the directional derivative means, actually, we'll be slicing our graph by the vertical plane.
55. The fish was barbecued Yemeni-style by slicing it in half, smacking the whole thing against the walls of a fire pit and baking it to a black crisp.
56. Root preparation: Peeling, slicing, and grating are critical to safely consumable cassava but also are labor intensive and non-mechanized.
57. The time slicing technique utilized by M/H system physical layer, which can effectively reduce the average power consumption of mobile terminals is also given.
58. We perseverate, and ugly thoughts circle in our mind, slicing jagged tears in the soul with every gyration.
59. If the target is a slicing: The primary expression in the reference is evaluated.
60. The technique of time slicing in DVB-H is studied and the effect of power conservation is researched by quantitative calculation.
More similar words: public interesticingdicingpricingenticingsluicingrejoicingservicingpublic international lawdeficit financingslicksliceslicedslicerslickedslickeroil slickfish slicecity slickervicinitymedicinemedicinalspicinessmudslingingplasticinelicitdriver's licenceslingingcold medicineelicit
Total 91, 30 Per page  2/4  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words