Sentencedict.com
 Directly to word page Vague search(google)
Home > Forming in a sentence

Forming in a sentence

  up(1)  down(0)
Sentence count:252+7Posted:2017-09-13Updated:2020-07-24
Similar words: performingconformingnonconformingbrainstormingstorm in a teacupa storm in a teacupfarmingwarming
Random good picture Not show
121 The cowrie concentrates its secretion along the sides of the mantle, forming a shell like a loosely clenched fist.
122 Externally, it is little altered, the mill house and mill now forming an elegant dwelling and farm.
123 Of the species whose vegetative propagation is rapid, the small plants forming a green lawn over the bottom prove most useful.
124 This was a small creek forming a marina, just along the convoluted coastline from Valletta. Sentencedict.com
125 It then approved an amendment calling for a new law on forming a government by July.
126 So will the sugar maple seedlings, for a while, forming a yellow carpet in the hardwood forest.
127 On the side streets up to Sixty-third, other groups are forming.
128 The entwined serpents forming a double helix gave birth to the Caduceus.
129 In my own perverse way, I approved of this single paradox in her newly forming, but not reforming, character.
130 He quickly met the inertia of a civil service used to forming and evaluating policy as well as carrying it out.
131 In general, as the difference in electronegativity between two elements forming a bond decreases, so does the bond enthalpy.
132 These special categories, forming a substantial part of the collection, present special difficulties because of their age, condition and value.
133 For there is no objection to people forming their own judgment on any issue they like.
134 And forgetting, startled[sentencedict.com], she looked for the hovering colour and saw a rainbow forming itself.
135 Also used to refer to a complete set of characters forming a family in a particular design or style.
136 A die and a template are both markers used for forming objects that will ultimately disintegrate.
137 The ice spread through his chest, forming around his beating heart.
138 One of the many important churches which are often so crucial in forming the townscape we see about us?
139 There are two distal oral papillae on each side of the jaw forming a continuous series with the infradental papillae.
140 It has generally been much more effective in forming the musical sensibilities of clergy than hit-and-run visits to theological colleges.
141 Living beings comprise a whole sequence of levels forming such a hierarchy.
142 The idea of each institution forming a coherent academic community seems to have little purchase in reality.
143 It achieves this by forming an ice barrier to lessen heat loss from the ground it covers.
144 This amount is equalled by naturally forming sulphur that originates mainly from volcanoes and huge clusters of marine bacteria.
145 She eventually became quite well educated, without forming any bad habits - in spite of herself!
146 Down those featureless slopes the rainwater drained, forming streams and rivers that began to erode the rock.
147 At the bottom of the plant a few small leaves develop, often forming a small bush.
148 Again, he learns to reconnect by forming a bond with a young boy.
149 The clay needs to be quite wet because the act of pressing and forming the clay tends to dry it.
150 In the stage when she begins forming her own inner values, her capacities for paying attention reach a new dimension.
More similar words: performingconformingnonconformingbrainstormingstorm in a teacupa storm in a teacupfarmingwarmingswarmingcharmingalarmingdisarmingsquirmingcharminglyalarminglyintermingledetermininghousewarmingheartwarmingintermingledprince charmingglobal warmingsubsistence farmingenormitydeformityreformistconformistdormitoryuniformityconformity
Total 252, 30 Per page  5/9  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words