Sentencedict.com
 Directly to word page Vague search(google)
Home > Forming in a sentence

Forming in a sentence

  up(1)  down(0)
Sentence count:252+7Posted:2017-09-13Updated:2020-07-24
Similar words: performingconformingnonconformingbrainstormingstorm in a teacupa storm in a teacupfarmingwarming
Random good picture Not show
91 The battle was now developing into a contest for possession of the plateau, with Confederate reinforcements arriving and forming around Jackson.
92 Mosses and lichens provide much of the patchy ground cover, forming mats rather than carpets with bare ground between.
93 The final forming of a person's character lies in their own hands. Anne Frank 
94 The first ventral arm plate is pentagonal with the lateral edges raised forming a boundary lip to the second oral tentacle pores.
94 Sentencedict.com try its best to collect and make good sentences.
95 Either way no surrender of judgment in the sense of refraining from forming a judgment is involved.
96 Thus subject departments and individual teachers are to be involved in forming curriculum policies rather than having rights over such policies.
97 On Feb. 21 Kravchuk held talks with opposition representatives on the possibility of forming a coalition government.
98 Some news show consultants believe in forming a television news pseudo-family to attract audiences.
99 The company would be interested in forming alliances to allow television companies use its lines to transmit information.
100 And then the dark-greens are by no means united in forming a simple statement of what it is to be an out-and-out green.
101 They coped by forming close relationships with a heterosexual partner or a group of women.
102 Species forming a short globular rhizome are pulled up and left floating in a well lighted tank.
103 And women in many developed countries are tending increasingly to adjust by forming non-legal unions that often produce offspring.
104 Serum is placed into a circular-well area and allowed to diffuse into the agar forming antigen antibody complexes.
105 There are 4-5 smooth arm spines, the proximal ones well separated midradially, not forming a fan.
106 A steady drip of blood was forming a pool on the floor.
107 Amplified vibration can reinforce the normal rhythm of speech and can greatly assist forming the right habits.
108 Water from the cross street swirled around its base, forming whirlpools before emptying into the sea.
109 Conversely, the availability of different types of housing also affects the ability of persons and families forming separate households.
110 In the Federal Republic, the parties participate in forming the will of the people.
111 They replace essential moisture whilst forming a protective layer to hold it in.
112 It will dissolve most dirt forming a solution that can be rinsed away.
113 As frozen crystals come into contact as water droplets they fuse together forming even bigger crystals.
114 Its roots are short but very dense, forming a rich white tuft.
115 With its loss of flow, the river's old mouth had silted up, thus forming the lagoon and swamp.
116 I thought it would be extraterritorial, out of society, forming its own new universe.
117 Forming alliances with other countries was the only way to match the power of the enemy.
118 Frostbite is the effect of ice crystals forming within the skin.
119 Turn left along this lane; a signpost points the way to Norber, a long limestone ridge forming the north-western skyline.
120 For non-mountaineers, the great feature of Knoydart is Loch Nevis, forming its southern boundary.
More similar words: performingconformingnonconformingbrainstormingstorm in a teacupa storm in a teacupfarmingwarmingswarmingcharmingalarmingdisarmingsquirmingcharminglyalarminglyintermingledetermininghousewarmingheartwarmingintermingledprince charmingglobal warmingsubsistence farmingenormitydeformityreformistconformistdormitoryuniformityconformity
Total 252, 30 Per page  4/9  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words