Sentencedict.com
 Directly to word page Vague search(google)
Home > Fellini in a sentence

Fellini in a sentence

  up(0)  down(0)
Sentence count:29Posted:2019-11-18Updated:2020-07-24
Similar words: tortellinifellow feelingjellingquellinggellingbellingyellingsellingMeaning: n. Italian filmmaker (1920-1993). 
Random good picture Not show
(1) Of course, Fellini would reject such intellectual speculations.
(2) In La Strada, Fellini and Rota also demonstrate the poetic power of film music.
(3) By 1965, Fellini had reached the pinnacle of his commercial success.
(4) Federico Fellini has consistently maintained that he was influenced by Roberto Rossellini more than any other single film-maker.
(5) This definition fits the description of a Fellini shooting script only in part, however.
(6) In Fellini, the town square is never felt to be the social center of a community.
(7) Fellini collaborated with Rossellini on the script of the film.
(8) Fellini lacked any formal training in cinematography and developed his personal style only after a long apprenticeship as a scriptwriter.
(9) In essence, the whole of Fellini can be found in this sequence from La strada.
(10) The shooting script is, for Fellini, more of a necessity of production than an artistic requirement.
(11) I've never seen a Fellini film.
(12) "Do you like Fellini?" he asked.
(13) There are tales also that Fellini grabbed the name from an opera but most of the evidence points to the Gissing book which had only just been translated into Italian.
(14) I could never touch Fellini and the brilliant[Sentencedict.com ], geniusmasterpiece of all time.
(15) The names Goethe, Guevara, Disraeli, Knopf, Schumann, Fellini, Hockney, Piaf, and Prospero rang no bell.
(16) Fellini said he did not need the images -- on Nino Rota's mind, the stories came up on the musical shape.
(17) Fellini has said he liked the name because it made him think of a buzzing stinging insect, which matched the character he was trying to portray.
(18) Fellini is known for combining realism and fantasy, often making up the story as he along.
(19) Stanley Kubrick is the quintessential auteur; like Fellini, Hitchcock and Allen(sentencedict.com), his vision permeates every aspect of the final product and his style is unmistakable.
(20) At the time there were two camps, the people who liked the Fellini film and the ones who liked L'Avventura.
(21) She spoke Polish to her maternal grandmother and watched movies of Federico Fellini and Satyajit Ray with her cinephile dad.
(22) It's the story of an Italian film-maker – a thinly veiled version of Fellini himself – who's trying to figure out his next movie.
(23) Margaret Atwood , the novelist, compared Mr. Calvino's urban landscapes'the early Fellini films'
(24) Margaret Atwood , the novelist, compared Mr. Calvino's urban landscapes to'the early Fellini films.'
(25) Like those of a few notable moviemakers before him — including Federico Fellini , Sergei Eisenstein , and Pier Paolo Pasolini — Burton's films are extensions of his drawings.
(26) For instance, his musics brought to life movies made by Fellini, Visconti and Francis Coppola -- mainly on The Godfather's trilogy, perhaps his most known composition.
(27) As they stood in line, Leonard had mentioned that the Film Society was playing a Fellini film that weekend.
(28) There's a little black and white, a little musical number, a little Fellini, which is always helpful in evoking a man in the act of yearning.
(29) It sounds like something one might expect to see in a Fellini film.
More similar words: tortellinifellow feelingjellingquellinggellingbellingyellingsellingshellingtellingspellingswellingsmellingdwellingfuellingcrystallinitytowellingflagellinlabellinglevellingexpellingvitellinerepellingmodellingcancellingtellinglycompellingimpellinggruellingpanelling
Total 29, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words