Sentencedict.com
 Directly to word page Vague search(google)
Home > Examples in a sentence

Examples in a sentence

  up(0)  down(0)
Sentence count:197+18Posted:2017-07-26Updated:2020-07-24
Similar words: examplefor examplegood examplecounterexampleamplesampletrampletrampled
Random good picture Not show
91. Many of the phrases that have conventionally been offered as examples seem rather artificial.
92. Northiam, on the Kent border, has three important examples of prosperous timber-frame building.
93. In these examples we see death and bereavement, together with other losses as an important aspect of work in counselling elderly people.
94. Only rarely, therefore, can we identify examples of agencies set up explicitly to circumvent problems of this kind.
95. These three examples suggest certain abilities in a new-born that can not fail to engage the attention of new parents.
96. There are numerous examples of kings themselves leading in battle.
97. These are fantasies of considerable charm, carefully crafted examples of story-telling.
98. An umbrella, hairspray or keys are examples of every day items you might carry and can use against your attacker.
99. A few examples of bibliographies are noted below, with brief comments on their type and function: 1.
100. Two examples are given overleaf Each of these can be calculated by several methods, one of which is by division.
101. We have already mentioned the marshes of Sussex and Kent as examples of areas drying out.
102. Obvious examples include caffeine and ephedrine, the latter being readily available to the public in over-the-counter cold remedies.
102. Sentencedict.com try its best to gather and make good sentences.
103. In Anisminic, Lord Reid gave the following examples: It may have given its decision in bad faith.
104. It contains a number of detailed examples of such work throughout the primary age range.
105. Examples of brilliance crop up in one in ten autistic children.
106. Toton and Tinsley are good examples of depots with specific sub-sector allegiances and covering a wide geographical area.
107. Typical examples are attacks on postmen or aggression towards an owner when a toy or other item is removed from them.
108. The treatment of engineering dynamics is almost invariably linear, although examples of simple non-linear formulations are provided.
109. The examples developed here are heavily biased towards the leadership and intellectual rationalization for the movement.
110. Further examples are given in the appendix to this section.
111. Respondents gave examples of situations where this would not reflect the substance of the arrangement between the borrower and the lender.
112. One can, therefore, quote only examples of this range, and two are given below.
113. Here are a couple of examples of people who made some interesting career changes.
114. Examples used to illustrate the theme included photographic film and a sectioned catalytic converter.
115. Other examples abound in the worlds of commerce, government, education(sentencedict.com), and organized sport.
116. A wide range of examples illustrate the text, designed to help teachers evaluate and adapt the materials they themselves use.
117. In a small glass cabinet are examples of Tennyson's clay pipes and writing quills.
118. Other examples of these chants are to be found in Chapter 5.
119. The finest architecture and the best examples of town planning are conceived with a clarity of vision that brooks no compromise.
120. Introduction to nonlinear problems with emphasis on practical modelling, illustrative examples from pure and applied science, and use of computers.
More similar words: examplefor examplegood examplecounterexampleamplesampletrampletrampledtrample onrandom samplequota samplesimple sugarexamexamenexamineexaminerexaminingfinal examexaminableexaminationcross-examineamplyamplifysamplingswamplandamplifieramplitudetemplewimplepimple
Total 197, 30 Per page  4/7  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words