Sentencedict.com
 Directly to word page Vague search(google)
Home > Arrhythmia in a sentence

Arrhythmia in a sentence

  up(0)  down(1)
Sentence count:106Posted:2017-08-01Updated:2020-07-24
Similar words: arrhythmicrhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionMeaning: n. an abnormal rate of muscle contractions in the heart. 
Random good picture Not show
1. Put simply, cardiac arrhythmia is an irregular heartbeat.
2. Listen: there go the goats, the faint arrhythmia of the bells on their collars, led by the white-clad peasant.
3. If an arrhythmia occurs at the time of syncope or near syncope, the diagnosis is established.
3. Wish you can benefit from our online sentence dictionary and make progress day by day!
4. Palpitation from frequent extrasystoles or other arrhythmia is common.
5. The heart frequently exhibits ventricular arrhythmia.
6. Sinus arrhythmia appeared in 15 % of beagle dogs.
7. Atrial Fibrillation (AF) is a commonly occurring cardiac arrhythmia.
8. Brady- Tachy Arrhythmia Syndrome: Ablation or Pacing?
9. Sinus arrhythmia also tends to disappear with advancing age.
10. Arrhythmia was finally controlled with amiodarone and digoxin.
11. He was also receiving diltiazem for cardiac arrhythmia.
12. Typically(sentencedict.com), catheter ablation is used to an AF arrhythmia.
13. During proecedure main cardiac arrhythmia found its expression in node tachycardia beat(81.8% ), ventricular premature contraction (45.5% ) and after procedure in sinus rate variation.
14. Perhaps once the heart arrhythmia cinnabar mole security lock on the slow songs into the memory of other field house, the yard deep.
15. According to clinical observation, the complications included: arrhythmia, breakout of capsule, air embolism, thrombosis and thrombus, catheter ablation tying, disjunction, infection, etc.
16. Electrocardiogram: Antrum sex arrhythmia, arrange Zhong Xiang dislocation. Is there a problem?
17. Arrhythmia could be elicited by electrical stimulation of amygdaloid complex.
18. It is revealed that "Xinjining Capsule" can fight arrhythmia by inhibiting K channel, prolonging action period and protecting ischemia.
19. The immediate reversal of the cardiac arrhythmia after epinephrine administration in this case suggests a direct relationship between the atrial fibrillation and the anaphylactic response.
20. Does arrhythmia calculate be fall ill? Should go seeing a doctor?
21. It is caused by their chemical imbalance, their emotional arrhythmia and their disenchantment with the world.
22. That non-detection is not a surprise to cardiologists, many of whom say arrhythmia can be difficult to find.
23. Patients with left ventricular ejection fraction greater than 30% and no inducible ventricular arrhythmia comprise a heterogeneous group.
24. Objective: To observe the changes of endocardium MAP and serum myocardium enzyme in arrhythmia and discuss its clinical significance.
25. In fulminant cases, it may lead rapidly to circulatory failure or malignant arrhythmia, causing mortality.
26. Objective : To study the anti - myocardial ischemia and anti - arrhythmia cordis effect of D - ribose.
27. This normal variation in rhythm is known as sinus arrhythmia.
28. The amount of OH. in effluxion of the coronary artery were measured by HPLC, the incidence of arrhythmia was recorded at the same time.
29. He was also receiving concomitant carvedilol and an ECG showed only inferior wall infarct without arrhythmia.
30. It is found that the normal conduction and abnormal conduction which induce cardiac arrhythmia are directly relatived with gap junction.
More similar words: arrhythmicrhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionwith might and mainlogarithmic scalecatarrhdiarrheadiarrhoeacarry the cancarry the daycarry througharrest warrantkashmirkashmirirhymemyrrhrhymingpyrrhicneophyteepiphyterhinorrheacirrhosisasthmaamenorrhoeahemorrhoid
Total 106, 30 Per page  1/4  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words