Sentencedict.com
 Directly to word page Vague search(google)
Home > Arrhythmia in a sentence

Arrhythmia in a sentence

  up(0)  down(1)
Sentence count:106Posted:2017-08-01Updated:2020-07-24
Similar words: arrhythmicrhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionMeaning: n. an abnormal rate of muscle contractions in the heart. 
Random good picture Not show
91. The ultimate cause of death is generally cardiac arrhythmia or cardiac arrest brought on by tissue degradation and electrolyte imbalances.
92. Study of arrhythmia in patients with positive responses head - up tilt table test.
93. This paper proposes a method of automatic ECG analysis and arrhythmia diagnosis for telemonitoring system.
94. Jones, who had a history of heart trouble, lay in his carport and died from cardiac arrhythmia.
95. Results 13 cases with cardiac arrhythmia and 5 cases with hypotension were observed, among the patients 3 died, 15 were alive.
95. Sentencedict.com is a sentence dictionary, on which you can find excellent sentences for a large number of words.
96. CONCLUSION: In myocarditis, expression of connexin 43 and desmin in the involved cardiac muscle cells was inhibited, resulting in dysfunction of gap junctional communication and arrhythmia.
97. The study revealed that nearly 10 % of SIDS ictims hae mutations or variations in arrhythmia - susceptibility genes.
98. Conclusion: Rhodiola has favorable anti - ventricular arrhythmia effects on arrhythmic animal models.
99. Likewise, when the receptor is absent or non-functioning, arrhythmia occurs.
100. But absorbing superabundance copper can lead to copper toxicity, inducing arrhythmia, even renal failure, uraemia, and shock.
101. Objective:Compare and analysis the types of cardiac arrhythmia in anterior acute myocardial infarction (AMI) and inferior AMI.
102. Objective : To systematically explore the present situation of thetreatment of ventricular arrhythmia caused by organic cardiopathy.
103. Their clinical symptoms were worsening of pre-existed cardiac arrhythmia, bile drained out from drainage tube, and biliary spillage from umbilical incision, respectively.
104. As the variation of QRS complex wave is the primary reference criteria on clinical diagnosis of arrhythmia, exact extraction of the features of QRS complex wave is the key problem.
105. Objective To research the effects of abdominal breathing training apparatus on heart rate and respiratory sinus arrhythmia (RSA).
106. Atrial fibrillation is a familiar arrhythmia in clinic. Anticoagulation is more important.
More similar words: arrhythmicrhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionwith might and mainlogarithmic scalecatarrhdiarrheadiarrhoeacarry the cancarry the daycarry througharrest warrantkashmirkashmirirhymemyrrhrhymingpyrrhicneophyteepiphyterhinorrheacirrhosisasthmaamenorrhoeahemorrhoid
Total 106, 30 Per page  4/4  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words