Sentencedict.com
 Directly to word page Vague search(google)
Home > Arrhythmic in a sentence

Arrhythmic in a sentence

  up(0)  down(0)
Sentence count:9Posted:2017-07-18Updated:2020-07-24
Similar words: rhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionlogarithmic scaleMeaning: adj. 1. not having a steady rhythm 2. without regard for rhythm. 
Random good picture Not show
1, Objective To observe the anti - arrhythmic effects of Water Extract Liquid of ShenBai with different constituents.
2, The present study demonstrates that sudden arrhythmic death is an important contributor to SIDS.
3, Class III anti - arrhythmic drugs ( such as amiodarone ) act ia prolongation of the action potential.
4, Conclusion Shensongyangxin capsule can block Ik 1, Ito and Ik, which may contribute to its anti - arrhythmic effect.
5, Objective To observe the effects of oxymatrine on action potential in normal rats and arrhythmic rats induced by aconitine .
6, Objective: To study the antiarrhythmic activity of taurine-magnesium coordination compound (TMC) in vivo by using the arrhythmic model induced by ouabain of guinea pig.
7, CONCLUSION: The increased DET and lengthened ERP of Oxy are its anti - arrhythmic mechanism.
8, Objective:To study the central receptor mechanism of the curative effect of scalp electroacupuncture on lateral line 1 of forehead in experimental arrhythmic rats.
9, Conclusion: Rhodiola has favorable anti - ventricular arrhythmia effects on arrhythmic animal models.
More similar words: rhythmicrhythmicalrhythmicallyrhythmbiorhythmrhythm methodrhythm sectionlogarithmic scalecatarrhdiarrheadiarrhoeacarry the cancarry the daycarry throughmicroeconomicsarrest warrantkashmirkashmirirhymemyrrhrhymingpyrrhicepiphyteneophytecirrhosisrhinorrheaasthmahemorrhagehemorrhoidamenorrhoea
Total 9, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
  • Fernando 2023-02-28 14:42:55
    .                                                                                                                            .                                                                                                                            Good morning                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                             
  • Esteban 2023-02-24 13:16:54
    hola .                                                                                                                            .                                                                                                                            mis amigos                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                          
  • Guillermo 2023-02-24 01:02:40
    Goodnight moon                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                              
  • Angelita 2023-02-23 19:04:04
    Goodnight moon                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                              
  • Ella 2023-02-23 14:11:24
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Angelita 2023-02-23 14:08:20
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Angelita 2023-02-22 14:56:24
    ∞                                                                                                                            ∞                                                                                                                            . ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                            ∞                                                                                                                         
  • Gandolf 2023-02-21 23:12:14
    .                                                                                                                            .                                                                                                                            ● I ♥ PonyExpress. It has more sentences containing 'arrhythmic' than sentencedict.                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                                                                                                            .                                       
  • Gandolf 2022-08-12 17:08:26
    ● SentenceStack.com is much better than sentencedict.com ●
  • me 2022-03-17 00:11:35
    I think lengusa.com is much better than sentencedict.com Į̷̛̛̮̟̜̼̘̞̹̭͙̭̻̮͚͈͓͚̩͎̮̦̝̩͇͔̐͌̏̿̈́͑̉̑͌̐̑̿́͐͝ͅͅ
More words