Sentencedict.com
 Directly to word page Vague search(google)
Home > Mer in a sentence

Mer in a sentence

  up(0)  down(0)
Sentence count:23Posted:2017-11-30Updated:2020-07-24
Similar words: merecomermerryhomermerittimeremmertamer
Random good picture Not show
1, After the incident, Foshan mer chants military group was dismissed.
2, After careful study of the coding scheme in MER system, some coding modulations that may be applied in future deep space communication are also discussed.
3, A human base on Meridiani Planum , now being explored by Squyres and his MER team, would be a good place to start.
4, Trimaran has a series of outstanding mer its, its excellent performance of speediness, sea-keeping and stability have made it a wide application.
5, Mer -ka-ba shapes have sharp edges that cut and pierce into rotational round-ended energy movement.
6, So rS 3 - 4 mer was digested into rS 3 monomers in vitro by 70 % formic acid treatment.
7, A rocket scientist invented Estee Lauder's La Mer,(http://sentencedict.com/mer.html) by fomenting mineral water and sea kelp.
8, Well, why don't you try the "La Mer" on Forty-second Street?
9, The MER, in the gray building across from the Ulaanbaatar Hotel, also grants visa extensions.
10, There would be no promenade en mer today the sea was too choppy.
11, The run culminated in open, undulating slopes towards the Mer de Glace.
12, Of his dishes, they recommended lobster with coriander, loup de mer, and pigeon with foie gras and truffles.
13, No one has captured the moods of the sea better than Claude Debussy in his symphonic sketches, La Mer.
14, Acrylic resin ( ACR ), as an impact modifier for R - PVC, was synthesized by latex interpenetrating poly - mer network technique.
15, However, the overall impression never rises beyond that of a poor man's version of Debussy's La Mer.
16, So your best protection is to stick with funds operated by major companies such as Fidelity, Merrill Lynch ( MER, Fortune 500), T. Rowe Price ( TROW), and Vanguard.
17, This is actually an ejecta field of rocks thrown about after the impact that created this huge crater where the rover is now traversing, and is an exciting region for the MER scientists to explore.
18, A voodoo believer prays inside a church during a religious ceremony to clean their souls at the town of Limonade, in a zone known as Borde du mer, Cap Haitien July 25, 2010.
19, Even when our designers produce sexy underwear they reach for French names - Agent Provocateur, Coco de Mer ... hell, it just sounds better in French.
20, FT-Raman and surface enhanced Raman spectra (SERS) of leucine and isoleucine, the only iso- mer in proteinic amino acids, on the silver colloidal substrate are recorded.
21, They , too, got that type of nausea that we call seasickness and that the French speak of as mal de mer , or 'sickness of the sea .
22, Pardonable they are alled over try a how he protects skin to taste, the puzzle that still can become LA MER Hai La finally forever epigone .
23, Partial decoding mode barrel shifter is adopted much more for its mer - its.
More similar words: merecomermerryhomermerittimeremmertamermercyformermergefarmersumeramercehammerdormermummerpalmerbummeryammerwarmerchimeraframerprimernewcomerdimmercameraemergerummermerger
Total 23, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words