Sentencedict.com
 Directly to word page Vague search(google)
Home > Acidifying in a sentence

Acidifying in a sentence

  up(0)  down(0)
Sentence count:27Posted:2018-10-22Updated:2020-07-24
Similar words: solidifyingacidifyedifyingunedifyingpacifyingacidificationunifyingossifying
Random good picture Not show
1. Again, acidifying old water is not suitable.
2. Once your water is soft it is easily acidified using peat filtration.
3. Bennett and Williams suggest that the cells of opening or closing traps acidify their own walls by releasing hydrogen ions.
4. It appears that deciduous trees do not acidify in this way.
5. Because cryptocorynes acidify the water, they form a favorable medium for the survival and spawning of many popular fish species.
6. Many plant cells rapidly expand when their cell walls are acidified; acid activates enzymes that increase the flexibility of cell walls.
7. Acidifying droplets can reduce the growth of trees and crops, at concentrations far lower, than had been suspected up to now.
8. The release of carbon dioxide has acidifying effect.
9. By acidifying the kaoline, aluminum salts and silica white can be obtained simultaneously. This is of practical significance for the comprehensive exploitation of clay mine in Fujian province.
10. Study was made on the hydrogen production from acidifying fermentation of sucrose- and starch-containing wastewater, and livestock wastewater by using anaerobically digested sludge.
11. Well cleanup technology of combined acidifying, liquid CO2 and air compressor blowout inducing method was used.
12. He agrees that the acidifying effects of nitrogen fertilizer deserve more attention in China.
13. The pH of seawater worldwide is dropping (acidifying) as oceans absorb ever more carbon dioxide from the atmosphere.
14. The most striking example of this involved the acidifying effects of elevated atmospheric carbon dioxide on coral reefs in the sphere's ocean biome.
15. Acidifying after bleaching is necessary but can result in the brightness decrease of the pulp, however it is not the case for APMP.
16. Oceans were rapidly warming and acidifying, water circulation was being altered and dead zones within the ocean depths were expanding, said the report.
17. Acidifying the raw materials could decrease the viscosity, which resulted in the improvement of fresh tea juice quality and the increase of juice extraction rate.
18. The acidifying foods are cheese, egg yolks, meat and milk and other rich sources of protein.
19. They start to clump together in the milk. The acidifying bacteria make the casein molecules more hydrophobic, and thus, less soluble.
20. Today's meetings also discussed a number of issues including Planetary Boundaries, Zeroing in and Acidifying Oceans. Possible solutions were brought up for discussion.
21. Fluorin boric acid acidification effect is best of all, little rock framework fabric breakage after acidifying , control particles moving effectively.
22. Acidification process of sugar-peptone manual make-up water was studied to determine the acidibility and acidifying degree of high concentration organic wastewater.
23. If we were to stop global warming with a sunshade, CO2 would continue to seep into the ocean, slowly acidifying it, and in time the ecological consequences would likely be dire.
24. This is the key understanding when it comes to figuring out which foods are acidifying and which ones are alkalizing.
24. Sentencedict.com try its best to gather and create good sentences.
25. This chart is intended only as a general guide to alkalizing and acidifying foods.
26. You're listening to Carol Turley, a senior scientist at the Plymouth Marine Laboratory in the U.K. Her research confirms that oceans are acidifying from atmospheric CO2.
27. Ultimately, curbing the CO2 emissions that are trapping extra heat—and acidifying the oceans, another stress on coral—is the only fix that can save the reefs.
More similar words: solidifyingacidifyedifyingunedifyingpacifyingacidificationunifyingossifyingverifyingpurifyingdeacidificationmortifyingrectifyingfalsifyingmagnifyingamplifyingqualifyingdignifyinggratifyingmystifyingclarifyingpetrifyingterrifyinghorrifyingidentifyingclassifyingintensifyingelectrifyinghorrifyinglygratifyingly
Total 27, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words