Sentencedict.com
 Directly to word page Vague search(google)
Home > Backtracking in a sentence

Backtracking in a sentence

  up(0)  down(0)
Sentence count:49+2Posted:2017-10-27Updated:2020-07-24
Similar words: backtracktrackingbackpackingtrace back tobackingrackingbacking upcracking
Random good picture Not show
31) The Earley algorithm , however , can completely avoid backtracking.
32) Backtracking from the grand speech before his defeat at Zanzibar Land, we already see the sympathetic Big Boss and his savior status with Gray Fox's tragic childhood, Dr.
33) Eight queens problem is an ancient and well-known problem, backtracking algorithm is a typical example.
34) This framework adopts backtracking algorithms to search for the best configuration to satisfy performance requirement.
35) This scheduling algorithm takes the bipartite graph matching and the backtracking techniques as mathematical tools.
36) The empirical methods in the manual procedures may be elucidated by some tentative control strategies of artificial intelligence (AI), namely, hierarchical planning and backtracking.
37) Backtracking techniques can be encoded by fairly short solution programs.
38) Eight queens problem is an old and well - known problem is a typical example backtracking algorithm.
39) You do not have to worry about backtracking and action side effects that may occur with an ambiguous grammar.
40) In a long string substring matching a short non - backtracking algorithm.
41) This paper studies redesign problem solving strategy theory based on dependency-directed backtracking in expert system for design.
42) We provide the algorithm of line segmentation under gray level image and character segmentation based on the biggest width backtracking algorithm to get the accurate position of characters.
43) An improving strategy is proposed in this paper, which combines a partial backtracking procedure with the scheme of filtered beam search.
44) In the constitution of backtracking algorithm, the solution space tree has the massive redundant solutions.
45) The backtracking mechanism is an important facility for programming in logic.
46) Meanwhile, it described bankers' model and abstract algorithm of safe state checking. Finally, it provided die detailed realization of safe sequence search algorithm based on the backtracking .
47) Stable marriage problem and the solving method Backtracking are described .
47) Sentencedict.com is a online sentence dictionary, on which you can find excellent sentences for a large number of words.
48) Backtracking to master the application of retrospective method with 0 - 1 knapsack problem.
49) Eight queens problem is an ancient and well-known problem is a typical example backtracking algorithm.
More similar words: backtracktrackingbackpackingtrace back tobackingrackingbacking upcrackingnerve-rackingnerve-wrackingfinancial backingback to backback-to-backpackingsackinglackinghackingstackingblackingsmackingwhackingattackingunpackinghijackingransackingcarjackingbe lacking insend packingbackbreakinggo back to
Total 49, 30 Per page  2/2  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words