Sentencedict.com
 Directly to word page Vague search(google)
Home > Widening in a sentence

Widening in a sentence

  up(2)  down(0)
Sentence count:175+4Posted:2017-11-18Updated:2020-07-24
Similar words: maddeninghardeningdeadeningsaddeninggardeningemboldeningwidenadenineMeaning: ['waɪdn]  n. 1. an increase in width 2. a part of a road that has been widened to allow cars to pass or park 3. the act of making something wider. 
Random good picture Not show
31. The demand could be met only by increasing and widening supplies.
32. If this is so then increasing the counselling skills of general practitioners may be preferable to widening the primary health care team.
33. All taxpayers will benefit from the widening of the 10p income tax band.
34. The net result was a widening gene pool and an altogether hardier national herd.
35. The widening of awareness and gaining of new insight associated with the latter is clearly identified with the aesthetic domain.
36. Yet this delayed-action disease manifested itself in widening circles and in larger numbers of people.
37. This was done by widening the participation in the exercise of political power.
38. The crudest fragments, totalling around 180,000 tonnes, have been used in widening the Berlin autobahn.
39. Obviously it was a time to reconsider the issue of widening both sets of locks.
40. As we move towards the end of the millennium the Association is increasingly widening its horizons.
41. Ace switched on the spacewalk jets and launched herself through the widening yawn of the doors.
42. Sadly, despite recently introduced performance bonus schemes, this gap is still widening.
43. She frowned, and checked again, her eyes widening in amazement.
44. The persistent pattern of inequality in economic, social and educational services has contributed to the widening gaps between regions.
45. Census Bureau data shows a widening gap between rich and poor since 1968, which has become increasingly wider in recent years.
46. The model was capable of taking on different shapes and widening as knowledge increases, to show this dynamic nature of communication.
47. By the end of World War I, however,(sentencedict .com) she faced a widening split with her radical allies.
48. Thirdly, there has been a widening of income inequalities among households with children.
49. He saw Mayli, and stopped, his eyes widening, his lips parting as if he were about to speak.
50. No one spoke of it but it was there, like a little moat between us, widening each day.
51. The appeal of a merger included widening Martineau's client base, a greater geographical spread and having more resources.
52. Recent changes in the social security system are likely to have intensified these widening income inequalities among families with children.
53. The Company had to pay £4,600 toward road widening in Penge and Anerley.
54. Even if it is not easy to make changes, it is important to begin widening horizons as soon as possible.
55. Yet, traditional criticism has generally been uninterested in the widening of vernacular expression among groups previously unable to record their voices.
56. Like a widening conveyer belt it scraped away more and more of the hillsides and carried off the debris.
57. This came to light in the present century during widening and repair operations.
58. I saw the light widening in the window, but I could not make myself get up.
59. They must also reimburse the company for any widening and road improvement carried out.
60. Higher slopes reveal widening seams of calcareous marl, sand and thin seams of marl, sandy-lignites and clayey-lignites.
More similar words: maddeninghardeningdeadeningsaddeninggardeningemboldeningwidenadenineopeningeveningmeningesgreeningwakeningraveningripeningfatteningconveningleaveninglisteninghappeningdeafeningmeningeallesseningchasteningdeepeningworseningsofteningdampeningawakeningscreening
Total 175, 30 Per page  2/6  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words