Sentencedict.com
 Directly to word page Vague search(google)
Home > Topping in a sentence

Topping in a sentence

  up(0)  down(0)
Sentence count:122Posted:2017-05-10Updated:2020-07-24
Synonym: top-flighttop-holeSimilar words: whoppingsoppingdroppingchoppingshoppinggo shoppingshopping mallshopping bagMeaning: ['tɑpɪŋ /'tɒp-]  n. a flavorful addition on top of a dish. adj. excellent; best possible. 
Random good picture Not show
1, The waiter went round topping up people's wine.
2, Tom Jones is topping the bill.
3, Distribute the topping evenly over the fruit.
4, Topping the bill is Robbie Williams.
5, Disadvantage: regular topping up is essential.
6, Topping the bill will be comedy impressionist Al Meechie.
7, Sprinkle on the remaining graham cracker topping.
8, Want a livelier meatloaf or a bolder pizza topping?
9, Put the butterscotch topping ingredients into a small pan.
10, Annual worldwide hemp sales are topping $ 75 million.
11, Bake 30 minutes or until topping is lightly browned.
12, Topping: Combine ingredients and spread mixture over cake.
13, My old outhouse is dangerously close to topping out.
14, The talk is of averaging down and topping up. The gamble goes on.
15, The topping was a melted chocolate bar,[http://sentencedict.com/topping.html] sprinkled with a handful of soggy peanuts.
16, They would stay with the building until topping out,[sentencedict.com] the traditional ceremony that marks the completion of the steel skeleton.
17, Dealers in Tesco were busy, with trading volumes topping 9m in the aftermath of Tuesday's profits announcement.
18, Topping the dinner menu were roadkill rabbit and squirrel, and of course also deer.
19, Tom Jones is topping the bill and among others, Joe Longthorne is guesting.
20, After ripening, use as a topping for pudding, pound cake or ice cream.
21, Topping believes Flexibots will have the kind of precision normally restricted to factory robots working in fixed, predictable environments.
22, Trading in Bunzl was fast and furious, volumes topping 6m as the market quote firmed a penny to 94p.
23, For the topping, melt the chocolate and butter in a bowl over simmering water or in the microwave.
24, Analysts predict the retailer will continue to bleed red ink, with losses topping $180 million.
25, The basic pizza is £6 and then each extra topping is 75p.
26, Children are being targeted in a huge merchandising campaign, with worldwide sales possibly topping £1.3 billion.
27, The detritus is deposited in a bag and the water re-circulated, so no topping up is required.
28, Four years in the making, the film is a jaw-dropping spectacle, with one bravura sequence topping the one before.
29, You can take your endowment loan with you when you move, topping up the policy to cover the extra amount.
30, Perfect puds Use rhubarb for a warming winter pudding with either a crumble topping or pastry.
More similar words: whoppingsoppingdroppingchoppingshoppinggo shoppingshopping mallshopping bagshopping cartshopping basketeavesdroppingdouble croppingdippingrippinglappingtappingdrippingflippingwrappingtrappingshippingsnippingclippingsnappingslappingskippingflappinggrippingequippingkidnapping
Total 122, 30 Per page  1/5  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words