Sentencedict.com
 Directly to word page Vague search(google)
Home > Hopping in a sentence

Hopping in a sentence

  up(1)  down(7)
Sentence count:128+2Posted:2017-05-19Updated:2020-07-24
Similar words: whoppingchoppingshoppinggo shoppingshopping mallshopping bagshopping cartshopping basket
Random good picture Not show
61, The hopping conduction in energy gap of amorphous semiconductors at low temperature is explained by calculating hopping probability when an electron hops from one defect center to the other.
62, Each data packet is transmitted on a different frequency channel, following a pseudo-random hopping sequence determined by the device address of the master device.
63, In this thesis, a new quasi-synchronous multiple access scheme suitable for FH communication system employing NHZ hopping code is proposed.
64, The main performance characteristics of AD9858 chip and its application to frequency synthesizer with fast frequency hopping is mainly introduced in detail.
65, Three were related to object control (kicking, catching and overhand throwing), and four were focused on locomotor skills (hopping, side galloping, vertical jumping and sprinting).
66, Random mode hopping in narrow line-width lasers is a significant factor that affects the stability of the optical system.
67, The different positions of hopping modes in the gain curve lead to different mode hopping points and intensity modulation curves.
68, Spread - frequency communication is a new kind of techniques one of which is Frequency - hopping ( FH ) .
69, On the basis of introducing the basic principles of DFH, the process of frequency hopping is modeled as the homogeneous Markov chain.
70, Next time you’re suffering from neck pain or a stress headache, try forgoing the Advil and hopping in the sack instead.
71, A handoff requires a connection establishment between a mobile device and a new base station which is a time-consuming procedure in the frequency hopping system.
72, Yoel named the birds hopping about: grackle, raven, blackstart, Smyrna kingfisher.
73, The frequency hopping coded signal is a new pulse compression radar signal, and has great analysis value.
74, It's propelled by hopping up and down like a pogo stick with both feet together on a footboard, and kept afloat on a centrally-placed wing once the correct speed is achieved.
74, Sentencedict.com is a sentence dictionary, on which you can find nice sentences for a large number of words.
75, It certainly had the sour - faced Arsene Wenger hopping mad on the touchline.
76, FH - OFDM is a technology that combines frequency - hopping ( FH ) and Orthogonal Frequency Division Multiplexing ( OFDM ) .
77, In addition the application of STFT for base band analytic signal based frequency hopping signal recognition, tracking and parameter extraction is investigated.
78, While bar - hopping you might a pool table and feel like a quick game or two.
79, Based on introducing the basic principle of DFH, the process of frequency hopping is modeled as a homogeneous Markov chain.
80, In a true mesh network——wired or wireless ——every node has a connection to every other node in the network, whether directly or via hopping though intermediate nodes.
81, The signal processor is a core circuit of a frequency hopping fuze.
82, Fast frequency hopping avoids interference Adaptive output power minimizes interference Short data packets maximize capacity during interference.
83, How Bohr brought the graininess into the atom, with electrons hopping between orbits in quantum jumps.
84, At last, we design a kind of OFDM-based fast frequency hopping(FFH) system(FFH-OFDM), and represent the FFH-OFDM system implement schemes.
85, Lute in hand, he sauntered to the dais, hopping nimbly over a corpse or two, and seated himself cross-legged on the high table.
86, Fast frequency hopping system is the system whose hop rate is above one thousand per second.
87, With increasing rearrange time, number of proton hopping decreases a little.
88, The calculating result in practical engineering shows that the transient effect on demodulation probability of error is very low even when the system frequency hopping is at middle-high speeds.
89, The performance of time hopping pulse position modulation (TH-PPM) UWB system using this wavelet monocycle was studied under additive white Gaussian noise (AWGN) channel.
90, The small polaron hopping is considered to be the main transport mechanism above the Curie temperature by comparing the experimental data with the theoretical results.
More similar words: whoppingchoppingshoppinggo shoppingshopping mallshopping bagshopping cartshopping basketsoppingtoppingdroppingeavesdroppingdouble croppingtappingdippinglappingrippingshippingsnippingflappingtrappingclippingwrappinggrippingskippingslappingflippingdrippingsnappingequipping
Total 128, 30 Per page  3/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words