Sentencedict.com
 Directly to word page Vague search(google)
Home > Chinook in a sentence

Chinook in a sentence

  up(2)  down(0)
Sentence count:33Posted:2017-08-30Updated:2020-07-24
Similar words: echinodermnooksnookeringlenookwashing machinenook and crannynooks and cranniesrhinoMeaning: n. 1. a warm dry wind blowing down the eastern slopes of the Rockies 2. a member of an important North American Indian people who controlled the mouth of the Columbia river; they were organized into settlements rather than tribes 3. pink or white flesh of large Pacific salmon 4. a Penutian language spoken by the Chinook 5. large Pacific salmon valued as food; adults die after spawning. 
Random good picture Not show
1. The winter-run chinook was listed as a protected species under the state and federal endangered species acts in 1989.
2. Chinook helicopters from Odiham were ready to evacuate casualties and to move troops to the forward areas.
3. While the hostages were being secured, two Chinook helicopters fought to keep the West Side Boys at bay.
4. Under these circumstances the Chinook can carry up to equipped men, and the Puma carries sixteen.
5. And the more he talked about fishing for Chinook salmon the more I wanted to go.
6. Chinook must make complex decisions in a large and complex space with many possible positions.
7. Nailing down the differences between sockeye and chinook salmon could take years, however.
8. They climb aboard Chinook and Blackhawk helicopters while assault Apaches provide cover overhead.
9. The combination of Chinook and ocean pout genes allow the AquAdvantage salmon to produce growth hormone all year round, so it grows incredibly quickly.
10. The catch included resident rainbow trout, juvenile chinook ? salmon , bull trout, coho salmon, steelhead and sculpin.
11. The Antibody against Chinook salmon ( Oncorhynchus tshawytscha ) growth hormone ( sGH ) was prepared by 4 cinjeations of sGH into rabbit.
12. These Spring Chinook salmon are heading for the Wenatchee River and Icicle Creek, in the shadow of the majestic Cascade Mountains.
13. These Spring Chinook salmon are heading for the Wanatchee River and Icicle Creek, in the shadow of the majestic Cascade Mountains.
14. The Chinook is a medium to heavy lift helicopter capable of transporting SP teams long distances.
15. Chinook salmon are popular with sport fishermen and account for over 60% of the fish caught in the Lake Ontario boat fishery.
16. NOAA is predicting strong chinook salmon returns to the Columbia River system this year, but those returns could be affected by the river and stream flows.
17. The other, taken from a chinook salmon, is a version of the growth-hormone gene itself.
18. Lake Ontario tributary chinook salmon takes a moment to pose for the camera before this release. Photo by Brian Bradfiled.
19. Injured earthquake survivors and family members sit on board a Chinook helicopter heading to Islamabad.
20. Particularly susceptible to those attacks is the twin-rotor CH-47 Chinook — the kind of copter shot down over the weekend in Afghanistan.
21. Western Alberta is protected the mountains and enjoys the mild temperatures brought by winter chinook winds.
22. Artillery support was provided by 4th Field Regiment and a Chinook from 5th Aviation Regiment was used to display rotary wing capabilities.
22. Sentencedict.com try its best to collect and create good sentences.
23. If selected, Boeing will build the Apache helicopters at its rotorcraft facility in Mesa, Ariz., and the Chinook helicopters at its rotorcraft center in Ridley Park, Pa.
24. Once the $325 million project is completed, locals will greet returning pink, Chinook, Coho, chum and Sockeye salmon—as well as the animals that rely on them, like black bears and bald eagles.
25. On the other, conservation authorities worry that overfishing will deplete the sockeye and chinook salmon stocks plying the Pacific Northwest waters.
26. IAC's HUMS systems are deployed on more than 500 aircraft, including the U.S. Army AH-64 Apache, C/MH-60 Black Hawk, C/M/HH-47 Chinook, and OH-6 helicopters.
27. It tells you how sustainable different fish are, as well as what the best choice is for any given species (e. g. , coho salmon vs. sockeye salmon vs. chinook salmon).
28. DAVIS, Calif., Sept. 1 (UPI) -- Warming in California streams could spell the end of spring-run Chinook salmon in the state by the end of the century, a study says.
29. But Saturday's attack marked the second time an insurgent RPG has brought down a Chinook helicopter.
30. This is a powerful spinning rod designed for drifting bait or bait imitators as well as casting spoons and spinners in rivers for Chinook salmon.
More similar words: echinodermnooksnookeringlenookwashing machinenook and crannynooks and cranniesrhinocash in onrhinorrhearhinocerosrain or shinechinrhinoplastychinechinkchinaetchingachingurchinchintzcome rain or shineretchingchintzyarchingkachinafetchingitchingmachinepitch in
Total 33, 30 Per page  1/2  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words