Sentencedict.com
 Directly to word page Vague search(google)
Home > Celtic in a sentence

Celtic in a sentence

  up(0)  down(2)
Sentence count:168+2Posted:2017-09-25Updated:2020-07-24
Similar words: multicellularmeltingpeltingsmeltingmelting potmelting pointpoulticebasalticMeaning: ['keltɪk]  n. a branch of the Indo-European languages that (judging from inscriptions and place names) was spread widely over Europe in the pre-Christian era. adj. relating to or characteristic of the Celts. 
Random good picture Not show
151 Gaelic, the old Celtic language of the Scots, is still heard in the Highlands and the Western Isles.
152 Latin did not replace the Celtic language in Britain as it did in Gaul.
153 Holly figured prominently in Celtic summer and winter solstice observances , and Romans used it extensively for Saturnalia celebrations.
154 He played keyboards in a Celtic band and founded the Frederick Jugglers.
155 Embodying large - scale Celtic motifs against a backdrop of Tartan,[http://Sentencedict.com] Isabella is a trendsetting statement design.
156 But on relegation he returned to Chelsea, and will now further his career at Celtic.
157 Aengus is the Celtic name, the Celtic master of love a certain kind of Irish version of Apollo.
158 Celtic home advantage so long enjoy the taste of the championship.
159 At that time the inhabitants of Britain spoke a Celtic language.
160 He did well in March against Sampdoria and Sparta Praha, he hit a post at Bologna and netted against Celtic.
161 Ireland's so-called Celtic Tiger turned out to be a low-tax haven fueled by property speculators and selfish bankers.
162 It is one of the Celtic Language, and is spoken in parts of the Highlands.
163 Originally an ancient Celtic settlement, it was a focal point of the Reformation after the arrival of John Calvin in 1536.
164 The Republic has made significant gains from its membership of the EU, earning the soubriquet Celtic Tiger for its economic progress.
165 Let's do one thing at a time, first Juve and then Celtic.
166 The celtic languages of Britain are a substrate for English.
167 When the Celtic Tiger was still roaring some years ago, Irish planners invested 300 million euros ($412 million) in an extension of a city tramline into the countryside south of Dublin.
168 The Yule log, cakes, and fir trees derive from German and Celtic customs.
More similar words: multicellularmeltingpeltingsmeltingmelting potmelting pointpoulticebasalticmulticolorsomatic cellmulticoloredmulti-colouredshelterbeltstatic electricitymulticulturalmulticulturalismhelter-skelterpoetic justiceanticlimacticweltmeltpeltbeltfeltkneltdweltdeltasmeltspeltmelt down
Total 168, 30 Per page  6/6  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words