Sentencedict.com
 Directly to word page Vague search(google)
Home > Celtic in a sentence

Celtic in a sentence

  up(0)  down(2)
Sentence count:168+2 Only show simple sentencesPosted:2017-09-25Updated:2020-07-24
Similar words: multicellularmeltingpeltingsmeltingmelting potmelting pointpoulticebasalticMeaning: ['keltɪk]  n. a branch of the Indo-European languages that (judging from inscriptions and place names) was spread widely over Europe in the pre-Christian era. adj. relating to or characteristic of the Celts. 
Random good picture Not show
1 The museum has a fascinating collection of Celtic artifacts.
2 Celtic are on a six-game winning streak.
3 Larsson's goal gave Celtic a deserved victory.
4 The Celtic word "geis" is usually translated as "taboo".
5 Celtic held the lead in the first half.
6 The sword is a fine example of Celtic workmanship.
7 In Celtic languages such as Welsh, there is a process of mutation affecting the beginning sound of a word,[www.Sentencedict.com] according to the word which comes before it.
8 Celtic have lost only once this season and will be a tough nut to crack.
9 Their faces are Celtic.
10 The Celtic Church maintained the Greek calendar over against that of Rome.
11 Their background is Teutonic, ours Celtic, of the Gael.
12 Fans live and breathe for either Celtic or Rangers.
13 Celtic music-meets-punk fiddler Ashley MacIsaac.
14 There are Celtic remains in the museum a well.
15 They let Celtic fire run(sentencedict.com), uninhibitedly.
16 Pic 18: Top Celtic bronze knife handle, value £120.
17 Yes, that was Billy's goal against Celtic.
18 Bremner bought a signed Celtic jersey according to Ed.
19 Charles likes to play Celtic music on his flute.
20 Celtic, however, are far removed from Leicester.
21 Now Celtic may have missed the boat!
22 Why, following the path of Celtic music, of course.
23 For the third time this season, Celtic outclassed their local rivals, Rangers, last night.
24 He loved the hierarchical structure of Celtic society because it was hierarchical, but also because it was extravagant.
25 The theme of creation is a recurrent motif in Celtic mythology.
26 Cumulatively, these archaeological discoveries give a very clear picture of Celtic life.
27 There have always been stories of human giants in Celtic legend and mythology.
28 He was the one who first set down the stories of the Celtic storytellers.
29 Sanskrit is related very closely to Latin, Greek, and the Germanic and Celtic languages.
30 Enya's success has contributed substantially to the current interest in Celtic music.
More similar words: multicellularmeltingpeltingsmeltingmelting potmelting pointpoulticebasalticmulticolorsomatic cellmulticoloredmulti-colouredshelterbeltstatic electricitymulticulturalmulticulturalismhelter-skelterpoetic justiceanticlimacticweltmeltpeltbeltfeltkneltdweltdeltasmeltspeltmelt down
Total 168, 30 Per page  1/6  «first  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words