Sentencedict.com
 Directly to word page Vague search(google)
Home > Chilling in a sentence

Chilling in a sentence

  up(1)  down(2)
Sentence count:150+3Posted:2017-05-04Updated:2020-07-24
Similar words: shillingchillimillingwillingspillingwillinglythrillingfulfillingMeaning: ['tʃɪlɪŋ]  n. the process of becoming cooler; a falling temperature. adj. so scary as to cause chills and shudders. 
Random good picture Not show
61) This may be evidence of some long past wine chilling exercise.
62) Behind the door is the storage room in which the chilling took place.
63) Preparation time (not including chilling): 5 minutes.
64) He was too legal,(http://sentencedict.com/chilling.html) chilling - unemotional.
65) Penbury always had a chilling effect.
66) He buttoned his thin coat against the chilling wind.
67) These chilling heroines make Hart's books compulsive reading.
68) The young pig is highly susceptible to chilling.
69) Exposure , chilling and fatigue are sometimes precipitating causes.
70) He continually made little, chilling differences between us.
71) The starch-sugar convertion and the contents of glycerol, total soluble sugars and reducing sugars in banana leaves were closely related to chilling resistance .
72) Changes in the distribution of light energy in photosystem and the phosphorylation of the thylakoid membrane proteins in rice leaves (Oryza sativa L. ) during chilling stress were studied.
73) She has a kid, she has been chilling and she should, Tedder explains.
74) Tantric master Wim (Iceman) Hof set another chilling Guinness World Record.
75) Other computer fraud experts said they found the verdict chilling.
76) He long with five hands, bloodshot eyes, makes chilling reading.
77) The meltwater from the glacier on top of the volcano ran down into the crater, chilling the magma and then the pressure from underneath caused an explosion.
78) The early mornings were foggy and chilling now, and the first rains of winter had begun.
79) But when it comes to how sexy a woman looks when she's all done up or just chilling in her sweatpants, men are all ears, or eyes we should say—they're visual creatures, what do you expect?
80) In northern Siberia, bone - chilling winds sweep down from the Pole.
81) The noise and exhaust can make Dai dizzy. To examine goods, he goes from one container to another in the chilling sea wind.
82) An effective and exact method was studied to mensurate chilling pork freshness.
83) The sedan camshafts re-melting and chilling process and production technique of shell mold camshaft castings to he re-melted and chilled were introduced.
84) The accumulation of proline in chilling condition was not induced through ABA, but it might be correlated to water stress induced damage on plants.
85) Therefore, it is urgent to enhance the genetic traits of chilling resistance in watermelon by the ways of combination of chemical mutagen and somaclonal variation.
86) Its applicable to industrial chilling , central air conditioning system , fish-pond chilling and ice storage air conditioning system.
87) The difference of chilling - resistance is probably related to the substitution of proline.
88) Gas hole and inclusion can be reduced by properly increasing thickness, and quality of the chilling layer, uniformly spraying and cleaning the mould cavity on time.
89) Chilling in May causes damages on early rice in the double cropping system.
90) These results suggested that flesh lignification was a senescence phenomenon in postharvest loquat fruits, and inappropriate chilling storage will promote the incidence of flesh lignification.
More similar words: shillingchillimillingwillingspillingwillinglythrillingfulfillingrolling millwillingnessunwillinglyunwillingnesschillchillychilledchill outachillesachilles' heelfill inachilles tendonsillinesswinston churchillpenicillingallingrollingpullingyellingmullingspellingsmelling
Total 150, 30 Per page  3/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words