Sentencedict.com
 Directly to word page Vague search(google)
Home > CIT in a sentence

CIT in a sentence

  up(0)  down(0)
Sentence count:19Posted:2017-07-04Updated:2020-07-24
Similar words: citycitetacitlicitinciteexcitecitruscitron
Random good picture Not show
1. The government decided against rescuing CIT Group -- and that has $ 54 billion of borrowings.
2. The first CIT will be delivered to RSK-MiG in 2010 and the first building block of a comprehensive secure identification capability in India mid-2011.
3. Based on information provided by CIT and its primary regulators, the Fed judged in December that the lender's capital, management and future prospects qualified it as a bank holding company.
4. This week, CIT and medium signs business sized businesses, sought bankruptcy protection from its creditors.
5. Since the surveillance area of sky wave Over-The-Horizon Radar (OTHR) is very vast, realizing the ship detection with short coherent integration time (CIT) is an operational requirement for OTHR.
6. Method:the different regions in temperature were selected by Cortical Infrared Thermograph (CIT), and microcirculation flow on the regions was measured by laser Doppler flowmetry(LDF)in 20 cats.
7. The US lender, CIT Group, has filed for bankruptcy protection, after debt - exchange offer to bondholders failed.
8. In morning trading, CIT shares fell 44 cents, or 61 percent, to 28 cents. The New York Stock Exchange said it would suspend trading in CIT prior to Tuesday's market open.
9. CIT Group, the small-business lender that lost its way in an ill-timed foray into subprime, is a perfect example of those quick reflexes.
10. CIT.N) has reached a tentative deal with a bondholder group for $3 billion in rescue financing, which the lender hopes will help it avoid bankruptcy, a source close to the situation said on Sunday.
11. CIT , a lender to small businesses, filed for bankruptcy protection under a reorganisation plan that had been accepted by most of its bondholders.
12. The CIT has practical value for research on acupuncture effects.
13. DNA sequence analysis conformed that 1 EBC and 1 CIT were new ampC gene.
13. Sentencedict.com is a sentence dictionary, on which you can find excellent sentences for a large number of words.
14. The bondholder group, which includes Pacific Investment Management Company (Pimco) and some other top CIT holders, is expected to provide the financing with a 2 1/2-year term, the sources said.
15. However, the ADI enzyme activity of JM 109 ( pBV 220 - cit ) had not been detected.
16. CIT has been in talks with the bondholder group to hammer out the rescue financing deal, Reuters reported on Saturday, citing a source close to the situation.
17. The results are valuable for the further development of CIT and its clinical applications.
18. Earlier this year, the Federal Deposit Insurance Corp and Utah state banking regulators put CIT Bank under a cease and desist order that prevents it from collecting new deposits.
19. The bondholder group, which includes Pacific Investment Management Company (Pimco) and some other top CIT holders, is expected to provide the financing with a 2 1/2-year term, two sources said.
More similar words: citycitetacitlicitinciteexcitecitruscitronelicitrecitelucitecitingcalciteopacityexcitedpaucitycitadelrecitalillicitcitizensolicittacitlydeficitferocityimplicitfelicitytenacityelicitedvoracityvivacity
Total 19, 30 Per page  1/1 
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words