Sentencedict.com
 Directly to word page Vague search(google)
Home > Fasting in a sentence

Fasting in a sentence

  up(3)  down(3)
Sentence count:126Posted:2017-03-04Updated:2020-07-24
Similar words: boastingeverlastingfastidiousfascinatingstingyprocrastinatetestingpostingMeaning: [fæst /fɑːst]  n. abstaining from food. 
Random good picture Not show
91 Ramadan is the ninth month of the Islamic calendar and Muslims are required to spend it in pious fasting and introspection.
92 Changes in antral motility induced by pentagastrin (G5) microinjected into the dor-sal vagal complex (DVC) were investigated in fasting conscious rats.
93 Objective To evaluate the value of reducing insulin resistance by preoperative carbohydrate loading and new preoperative fasting protocol in patients following abdominal surgery.
94 Methods 24 hour urinary ablumin ( Alb ), transferrin ( TRF ), IgG, retinal - bingding protein ( RBP ), N - acetyl - glucosaminidase ( NAG ) , fasting blood glucose, < ...
95 Results In the rats of fasting group, the rate of intestinal transit was delayed compared with control group, the content of nitrergic nerves in the myenteric plexus of rat intestine higher than...
96 No association was observed between impaired fasting glucose or undiagnosed type 2 diabetes and depressive symptoms.
97 To make the criteria and method with no loss and fasting resolution for received wafer and mixed-up wafer, apply to produce.
98 "The grim situation is frustrating people who are fasting in the hot Ramadan", said the prelate, who will celebrate Eucharist on the final day of the pilgrimage.
99 The suggestion of lowering the fasting plasma glucose may in fact be a reasonable approach. We have to remember that glucose level is a continuous distribution and there is no specific cut point.
100 That noon he sat down to dinner with us, and received a heaped-up plate from my hands, as if he intended to make amends for previous fasting.
101 During fasting, the blood in hepatic portal vein only contains small amount of glucose (NOT: without glucose),(www.Sentencedict.com) because there is no absorption of digested food in the ileum.
102 CRP and SAA in fasting blood serum and gingival crevicular fluid of all subjects were detected by immune photoextinction .
103 Fast twice a week – Fasting was not commanded in the Mosaic Law except for the fast on the Day of Atonement.
104 Then he goes into fasting,here's how you're supposed to fast: Your fast must not be identical with those of the hypocrites.
105 My knees give way from fasting; my body is thin and gaunt.
106 Colesevelam therapy was associated with consistent reductions in fasting plasma glucose and fructosamine levels, glycemic-control response rate, and lipid control measures.
107 Methods The fasting serum CA125, CA199 and CEA level of patients with ovarian tumors were measured by electrochemiluminescence before operation.
108 After fasting forty days and forty nights, he was hungry.
109 When the fasting gastric acidity, lactic acid easily be killed.
110 Fasting the day of 'Ashura' ( Muharram 10) is an expiation for the year preceding it.
111 You can achieve this by a low-calorie diet, fasting days and physical exercises.
112 Objective:To investigate impaired fasting glucose(IFG) distribution and the relationship between it and adiposis hepatica, hyperlipemia.
113 Intermediate hyperglycemia(IHG) is defined as concentration of blood glucose between normoglycemia and diabetes mellitus including impaired fasting glucose(IFG) and impaired glucose tolerance (IGT).
114 Manichaean worship included fasting, daily prayers, and sacramental meals which differed greatly Lord's Supper.
115 They put on a face, so people can see they are fasting.
116 The 40 weekdays from Ash Wednesday until Easter observed by Christians as a season of fasting and penitence in preparation for Easter.
117 An oral glucose tolerance test was used to ascertain 2 - hr plasma glucose and fasting plasma glucose.
118 But this kind does not go out except by prayer fasting.
119 This hadith directs us to a further meaning and message of fasting which is related to the personal development of the fasting person himself and the refinement of his character and morality.
120 He has sharply escalated his profile in recent weeks, however, by invoking India's Gandhian tradition of fasting to evince political change.
More similar words: boastingeverlastingfastidiousfascinatingstingyprocrastinatetestingpostingexistingprocrastinationexhaustingstinginessdevastatingdistinguishinterestingstimulatingdistinguishedundistinguishedfastfastensteadfastbreakfasthard and faststintswastikamastiffpastimedrasticplasticchastise
Total 126, 30 Per page  4/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words