Sentencedict.com
 Directly to word page Vague search(google)
Home > Eel in a sentence

Eel in a sentence

  up(3)  down(2)
Sentence count:133Posted:2017-06-09Updated:2020-07-24
Similar words: seelfeelkeelreelpeelheelsteelwheelMeaning: [iːl]  n. 1. the fatty flesh of eel; an elongate fish found in fresh water in Europe and America; large eels are usually smoked or pickled 2. voracious snakelike marine or freshwater fishes with smooth slimy usually scaleless skin and having a continuous vertical fin but no ventral fins. 
Random good picture Not show
61. The Umbrella Mouth Gulper Eel (Eurypharynx Pelecanoides) can open its "Umbrella Mouth" to Pelican-like proportion, accommodating prey much larger than its size.
62. Beware of that peddler, for he is slippery as an eel.
63. Will ducked, darted inside its reach, and battered its bruised midsection—punching through flesh and ripping out wriggling chunks of the composite eel colony.
64. These results indicate that growth promoting eel feed has effects on increasing survival, feed efficiency, and decreasing feed cost.
65. Acaleph, coral, actinia , electric eel, seaweed, shark, whale, seal...
66. Stewed red shark, baked oysters, clear beef broth Eel Ukrainian ears are the representation of Chaozhou Cuisine's seafood .
67. Another famous example is the electric eel. This Fish gives an even more powerful shock.
68. This might be the only solar-powered Christmas tree lot in the world, but a Christmas tree in an aquarium near Tokyo is powered by an electric eel. Sentencedict.com
69. They allegedly had a very close encounter with a creature like a giant moray eel, which literally scared them out of the water.
70. A method for detecting florfenicol residue in eel muscle was established.
71. The invention provides a medicine treating tympanitis, which comprises 100g fresh eel blood, 10g earthworm dried powder, 5g musk dried powder, 2g toadfish dried powder and 50g French chalk.
72. The eel has a real "continuous" vertical fin along the back (dorsal fin).
73. A diver swims with a moray eel during a press preview at the Sunshine Aquarium in Tokyo.
74. A moray eel lurks outside a cage full of fish in the Caribbean Sea.
75. OFFER ALL KINDS OF SPECIFIC ROASTED EEL , PRAWN[Sentencedict.com], AND FILLET.
76. "We now understand how the natural electric eel cells work," said David LaVan of NIST.
77. He is as much out of his element as an eel in a sandbag.
78. The peculiar life cycle of the freshwater eel was almost tailor-made for the harvest season, and for stockpiling food for the winter.
79. Atomic Absorption Spectrophotometry(AAS) and gas phase osmometer were conducted to analyse the chemical composition and osmotic pressure of seminal plasma of cultured golden trout and Japanese eel.
80. 'I'm Ben Gunn, I am,'replied the maroon, wriggling like an eel in his embarrassment.
81. Fisheries in order to catch octopus, pomfret, eel, fish, mainly the United States.
82. A proposal was also raised for development and culture of mandarin fish, snakehead, rice field eel, freshwater shrimp, Acipnser sinensis, Myxocyprinus asiaticus.
83. The finless eel ate the earthworm in front in one bite.
84. Valentine's Bay, you can often catch the fish: grouper, Tsing Yi, sea carp, river vein, eel, red snapper, parrot fish.
85. Natural electric eel cells generate and release electric pulses of more than 500 volts with eight different channels and pumps.
86. But although the tree in the lobby may appear traditional in shape and trimmings, the electricity that powers its lights is coming from a very unconventional source: an electric eel.
87. The effects of trehalose on actomyosin of salted pike eel muscle were first investigated.
88. This paper studies a regularity by Aeromonas hydrophila bringing about hemorrhagic septicemia of Mud eel.
89. The most famous is the electric eel, which a colleague of Markham's termed "a frog with a cattle prod attached," but most animals use the electrical signals in more subtle ways.
90. Natural electric eel cells are about 14 percent efficient at converting sugar into electricity, compared to 19 percent for the engineered cells.
More similar words: seelfeelkeelreelpeelheelsteelwheelheelskneelkeeledpeelerfeelersteelyfeel outfreelybeelinefeel badfeelingpeelinggenteelnewsreelpinwheelkneelingfeel likefeelingsfeel up tounfeelingcartwheelwheelbase
Total 133, 30 Per page  3/5  «first  pre  next  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words