Sentencedict.com
 Directly to word page Vague search(google)
Home > Meningioma in a sentence

Meningioma in a sentence

  up(0)  down(0)
Sentence count:86Posted:2017-10-12Updated:2020-07-24
Similar words: meningitismeningeomameningesmeningealeveningopeningraveningwakeningMeaning: n. a tumor arising in the meninges which surround the brain and spinal cord; usually slow growing and sometimes malignant. 
Random good picture Not show
61. Objective To observe the curative effect of microsurgery on parasagittal and parafalcine meningioma in the functional area.
62. Objective To explore clinical features, operational technique and therapeutic efficacy of lateral ventricular meningioma.
63. Results Signal intensity on T2WI was non- specific though it had certain correlation with the degree of cellularity of meningioma.
64. Pathological types include 13 cases of meningioma, 6 of neurinoma, 1 of chordoma, 1 of choroid plexus papilloma, and 1 of hemangiopericytoma.
65. Objective To improve the curative effect of microsurgery on parasagittal meningioma.
66. Conclusion: The PCNA index assay may correctly reflect the proliferating activity of the meningioma, it may be adopted as an indictor for subsequent therapy and co...
67. AIM To improve the diagnostic level and surgical curative effects of parasagittal meningioma.
67. Sentencedict.com try its best to gather and build good sentences.
68. In our series, the incidence of various ventricular neoplasms (shown in decreasing order) were metastasis, astrocytoma, ependymoma, meningioma, choroids plexus papillomas and oligodendroglioma .
69. At medium power, this meningioma is composed of whorled nests of cells.
70. Results All 22 cases of meningioma were totally resected with no operation death, mutilation and complications.
71. Conclusion: MRI is an effective method in diagnosis of hemangioblastoma, however, the atypical tumors should be differentiated from glioma, simple cyst, meningioma and AVM.
72. Meningioma has a variale neuroimaging and some special characteristics are connected with histopathological subtypes and prognosis.
73. Conclusion Hydroxyurea can inhibit the proliferation of meningioma cells by inducing apoptosis.
74. Conclusion Patients with tentorial meningioma could obtain better quality of life and survive longer following microsurgical removal.
75. Results 5 cases with meningioma were located in intrasellar region. 4 cases in the tuberculum sella, 1 case in the diaphragma sella.
76. Objective: By providing detailed and relative anatomical date for clival region approach , to raise the removal degree and improve the post operative result of the petroclival meningioma .
77. It is believed that application of CT and angiography and microsurgical technique is helpful for the diagnosis and treatment of sphenoidal ridge meningioma.
78. Results The vascularized meningioma was mainly supplied by the middle meningeal artery, ascending pharyngeal artery, occipital artery, internal maxillary artery as well as submeningeal artery.
79. Conclusions The therapy method of lateral ventricular meningioma exairesis of microsurgery is safe and effective.
80. Methods Adopting presigmoid sinus approach and using micro neurosurgery technique, deblocking the petroclival meningioma and then making total tumor resection or partial tumor resection.
81. These lesions include 6 meningioma, 4 glioma, 2 inflammatory granuloma, 3 hemangioblastoma, 1 lipoma, 1 trigeminal neurofibroma and 1 parasite infection.
82. Radiolabelled glucose, amino acid and ligand are commonly used as PET tracer in meningioma diagnosis.
83. Results Extramedullary tumors were found in 34 cases, mainly including neurinoma and meningioma, and intramedullary tumors in 5 cases.
84. To explore the clinical outcome of microsurgery in the treatment of meningioma at the trigone of lateral ventricles.
85. Clinical differential diagnosis includes fibrous dysplasia, osteoma, dermoid cyst, meningioma, eosinophilic granuloma, Lagerhan cell histiocytosis, and metastatic disease.
86. Objective To investigate the hyperostotic changes in meningioma of the cranial base associated with tumor invasion.
More similar words: meningitismeningeomameningesmeningealeveningopeningraveningwakeningleningraddeadeningworseninglesseningfasteningweakeningleaveningconveninglisteningscreeninggardeningsickeningsofteningdeafeningdarkeningdampeningfatteningchasteningmaddeninghappeningsaddeningawakening
Total 86, 30 Per page  3/3  «first  pre  last»  goto
Leave a comment
Welcome to leave a comment about this page!
Your name:
Latest commentsInto the comment page>>
More words